KEGG   Acidihalobacter prosperus: BI364_13040Help
Entry
BI364_13040       CDS       T04495                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
aprs  Acidihalobacter prosperus
Pathway
aprs00361  Chlorocyclohexane and chlorobenzene degradation
aprs00625  Chloroalkane and chloroalkene degradation
aprs01100  Metabolic pathways
aprs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aprs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BI364_13040
   00361 Chlorocyclohexane and chlorobenzene degradation
    BI364_13040
Enzymes [BR:aprs01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BI364_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AOU98768
UniProt: A0A1D8IQI2
Position
2708913..2709608
Genome map
AA seq 231 aa AA seqDB search
MSITTERSIEACLFDAYGTLFDVHAATATVAQRIGTRWQAFSAHWRERQLQYSWIRGLTG
RHADFWQVTCDALDHALEAYDLDPALHREPLLMAYRRLGAYPDVLPAIDRLRAMGLRCGI
LSNGSPDMLADAVGAAGLADHLDPVLSVESVGRYKPAPEVYAMAAERLDLAPAHVLFVSS
NGWDAFSAKAYGFRVAWCNRAGLPAERLPDPPDAIVASLDELPALAESLTG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcacgaccgagagaagcatagaagcttgcctattcgacgcttacggcacgttg
ttcgacgttcacgcggccaccgcaacggtcgcccagcgcatcggcacacgctggcaggct
ttttccgcgcactggcgcgaacgccagctacaatacagctggatacgcggcctgaccggg
cgtcatgcggacttctggcaggtcacgtgcgacgcccttgatcatgcgctggaggcctac
gatctcgatcccgccctacaccgtgaaccgctgctgatggcctatcggcgactcggcgcc
taccccgatgtgttgcccgccatcgaccgcctacgtgccatggggttgcgctgcgggatt
ctctccaatggctcgcccgacatgctcgcggatgcggtgggtgcggcaggcctggcagat
cacctcgacccggtgctgtcggtggaatcggtcggccgctacaagcccgcgccggaggtc
tatgcgatggccgccgagcggctggatctggcgccggcccacgtgctgttcgtctccagc
aacggctgggatgccttctcggccaaggcctatggctttcgggtcgcctggtgcaaccgc
gccgggctgcccgccgagcgcctgcctgatccgccagatgcaatcgtcgcgtcgctggat
gagctgcccgcgctggccgaatcgttgaccggttga

DBGET integrated database retrieval system