KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_135Help
Entry
CFPG_135          CDS       T00792                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00900  Terpenoid backbone biosynthesis
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFPG_135
Enzymes [BR:aps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CFPG_135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAG83398
UniProt: B6YQC6
Position
155296..156099
Genome map
AA seq 267 aa AA seqDB search
MIAFPNAKINLGLHVIARRSDGYHDIETIFCPIDLCDILEIVSATQTKFIQSGIPMDCKV
SNNLVMKAYQLLKKHYNLPEITIHLRKNIPIGAGLGGGSSDASFMLYLLSNLANLCLSIE
ELEAYAKQLGSDCPFFIRNKPVFAKGIGNIFTPIELDLKKYNLALVTTNIHISTSEAYTN
IVVSHTPRESLTDIIHYPVDKWKNRLVNDFEEDIFPLYPEIREIKQELYNQGAIYASMSG
SGSSVYGLFKKPYRPIGTFNFSIHNFI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttttccaaatgctaaaatcaatttgggtctccatgtaattgcacgaagatca
gatggttaccacgatatagaaacaattttttgtcccattgatttgtgcgatattttagaa
attgtttctgcaactcaaacaaaattcatccaaagtggaataccaatggactgcaaagta
tcaaataatctggtaatgaaagcataccaattattgaaaaaacattataacctaccagaa
ataacaattcatcttcgcaaaaacattcctataggagcaggactcggaggaggaagtagt
gatgcgtcttttatgctttacttattaagtaatcttgctaatttgtgtctatctattgaa
gaattagaagcttacgcaaaacaattagggtcagattgtccattctttattcgaaataaa
ccagtatttgccaaaggaataggaaacatctttaccccaatagagttagatctcaaaaaa
tataatctggccttagtaactacgaatattcacatttcaacatcagaagcatatactaat
atagtagtatctcatacacctagggaatctcttacggatattattcattatccagtagat
aaatggaaaaatcgtttagttaatgattttgaagaagacatattccccctttatcctgaa
ataagagaaataaaacaagaactatacaatcaaggtgccatttacgcaagtatgtctgga
tcaggatcttcagtttatgggttatttaaaaaaccttaccgtccgataggaacattcaat
ttttccattcataattttatctaa

DBGET integrated database retrieval system