KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_278Help
Entry
CFPG_278          CDS       T00792                                 

Definition
(GenBank) hydroxymethylbilane synthase/uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00860  Porphyrin and chlorophyll metabolism
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CFPG_278
Enzymes [BR:aps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CFPG_278
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CFPG_278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deam TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: BAG83541
UniProt: B6YQR9
Position
387313..389361
Genome map
AA seq 682 aa AA seqDB search
MDTSKFSKGNLRVISRNSPLSLLQVKEVFSFFPNIDYQLITIESFGDKNKHVALFDISNV
SSFFLEEESISDFFTRELDEALIYNKADIAVHSAKDLPYPLPYDLELFALFQAMDKSDSL
ISRNNLTLEQLPPRARVGTSSQKRKTELLKIRPDLEVVSIRGNIEERIAKMDNGFIDALI
VATCALIRLGMEARIACILPFETHSLQGNLAIVGRKNDKNVKNLFCIQDIRKRYGKVSLV
GFGPGDPDLLTIGGYKALLSADIIFYDDLLNQEFLSRFLVEKVYVGKRKEVHRFHQGEIN
EFLYREAISGKRVVRLKGGDPMIFAHGREEIDFLQSRFVEVNIIPGISSGIAMSSYTHIP
LTYRGLASSVAFVTGHSEENIQVPTTDTLVYYMSGANLSVIARKLIAVGRREDLPVALIY
SVSLPNQKIWYSSLKELQYSIIKYPTPILLIIGEVVSFEKKETCKSQVLLTGTSNETSIR
YVNAIHTPLIKINKIENNKRLYTSIKEISVFDWIIFTSRYGVYYFFESLNEMKLDMKVLS
AVYIASVGKATSLELNKHGFYADIESESESAEGLINYFKVMRLTRKRILLPRSNRGLKYL
SELLEQLGNEVIDIPVYTNEINDKAEKVDLSFFQKIVFSSPSGVNAFIQLYRMLPSGIQM
IAKGKTTFSSLFSFFKIDSIRN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggatacttctaagttttcaaaaggaaatttaagggttattagtaggaacagtcctctt
tcattgcttcaagtgaaggaagtcttctcattttttccgaatattgattatcagttaata
actatagaatcgtttggagataagaataaacatgttgccttgtttgatatatctaatgta
tcttctttttttctagaagaagaaagcatttcagatttttttacgcgtgaattggatgag
gcattgatttataataaagcagatattgctgttcattcagccaaagatttgccttatcct
ttaccatatgatttagagttatttgctctatttcaagcaatggataagtctgattctttg
attagtagaaataatttgacattagaacagttacccccaagagcaagggttggtacgagt
tctcaaaaaagaaaaaccgaattgttgaagattcgtcctgatttggaagttgtaagtatt
cgtggaaatattgaggaacgcatagctaagatggataatggttttatagatgctttaatt
gtagctacttgtgcattaatacgattagggatggaagctcgcatagcttgtatacttcca
tttgaaacccattccttgcaagggaatttagctattgttggacggaaaaatgacaagaat
gttaaaaatttgttttgtatacaagatatacggaaaagatatgggaaagtaagtttagtt
ggatttggacctggtgatcctgatctgttgactattggaggatataaggctttgttatca
gctgatattattttttacgatgatttattaaatcaagagtttctttctcgatttttggta
gaaaaagtgtatgtaggtaaaagaaaagaagttcaccgatttcatcaaggtgagattaat
gaatttctttaccgggaagcaatttcaggaaagagagtagtgagattaaaggggggggat
ccaatgatttttgcacatgggcgtgaagagattgattttttacagagtcgttttgtagag
gtaaatattattccaggtatttcttctgggattgctatgtcttcttatacacatattccg
ttgacatatagaggattagcatcttctgttgcttttgtaactggacattcagaagaaaat
atacaagttcccactaccgatactttggtttattatatgagtggtgctaacctgtctgtg
attgcaagaaaattgatagctgtagggcgtagggaagatttgcctgtcgctttgatttat
agtgtttcgttaccaaatcagaaaatttggtattcttcattgaaagaactacagtattca
attattaaataccctactcctattttattgataataggtgaagtagtttcatttgaaaaa
aaagaaacatgtaaaagtcaagtattattaacagggacttccaatgaaactagtattcgt
tatgtaaatgcaattcatactcctttaattaagataaataagatagaaaataataaacgt
ttatatacttctataaaagagataagtgtttttgattggattatttttactagtcgttat
ggtgtctattatttttttgaatcattaaacgaaatgaagttagatatgaaagttttatct
gctgtttatatagcttcggttgggaaagcaacctctttggaattaaataaacatggattt
tatgctgacatagaatcagaaagtgaatcggcagaggggttgattaattatttcaaagtt
atgcgattaacaagaaagcggatattgcttcctcgttcgaatagaggcctgaaatatctt
tctgaattattggaacaacttgggaatgaagtaatagatattccagtatatactaatgaa
ataaatgataaagcagagaaagtagatttgtctttttttcaaaaaattgttttttcttct
ccttctggagtaaatgctttcatacaactttacagaatgttaccttctggaattcaaatg
attgcaaaaggaaaaactacgtttagttcattgtttagtttttttaaaatagattctatc
cgaaattga

DBGET integrated database retrieval system