KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_654Help
Entry
CFPG_654          CDS       T00792                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00010  Glycolysis / Gluconeogenesis
aps00051  Fructose and mannose metabolism
aps01100  Metabolic pathways
aps01110  Biosynthesis of secondary metabolites
aps01120  Microbial metabolism in diverse environments
aps01130  Biosynthesis of antibiotics
aps01200  Carbon metabolism
aps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFPG_654
   00051 Fructose and mannose metabolism
    CFPG_654
   00562 Inositol phosphate metabolism
    CFPG_654
Enzymes [BR:aps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CFPG_654
Exosome [BR:aps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CFPG_654
  Exosomal proteins of bladder cancer cells
   CFPG_654
  Exosomal proteins of melanoma cells
   CFPG_654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAG83917
UniProt: B6YRU5
Position
complement(946137..946892)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVVGNWKMNKTLQEGVFLAKELELALKERKVNCDVIICVPFTHLVAIFETINTKIV
KLGAQNNADRVSGAYTGEVSAAMIASIGVQYVILGHSERRAYYGETNIILKEKVKMALEN
NLIPIFCIGEVLKERVAGKQNIVVRKQIEESLFDFSAEDFRKIILAYEPVWAIGTGRTAT
PVQVQEMHIFIRQILIDNYGQAIANETSILYGGSCNAGNAKELFINPDVDGGLIGGASLK
VDTFLSIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgtagtggggaactggaaaatgaataagactttgcaagaaggagtt
tttttagcaaaggaactagaattagctttaaaagagagaaaagtaaattgtgacgtaatt
atctgtgtaccttttactcatcttgttgccatcttcgaaacgattaatacgaaaattgta
aaattgggagcacaaaataatgcagatagagtttctggtgcttatacgggagaagtttct
gccgctatgatagcatctattggtgttcaatatgttatcttggggcattccgaacgacgt
gcttattatggagaaactaatattattttgaaagaaaaagtgaagatggcattggaaaat
aatcttatccctattttttgtataggtgaagtattaaaagaaagagtagctggtaaacag
aatattgtagtgaggaagcagatagaagaaagcttatttgatttttcagctgaagatttc
agaaaaatcattttagcttacgaaccagtatgggcaattggtacaggaaggacagctact
ccggttcaagtgcaagaaatgcatattttcattcgtcaaatattgattgataattatggg
caagctattgcaaatgaaacatcaattctttacgggggaagttgtaatgctggtaatgct
aaagaattgtttattaatccggatgtggatggcggattaattggaggggcatctctcaaa
gtagatacatttttgtcaattatcgaagcattttga

DBGET integrated database retrieval system