KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_718Help
Entry
CFPG_718          CDS       T00792                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00330  Arginine and proline metabolism
aps00332  Carbapenem biosynthesis
aps01100  Metabolic pathways
aps01130  Biosynthesis of antibiotics
aps01230  Biosynthesis of amino acids
Module
aps_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CFPG_718
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CFPG_718
Enzymes [BR:aps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CFPG_718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAG83981
UniProt: B6YS09
Position
1054414..1055484
Genome map
AA seq 356 aa AA seqDB search
MKRIAIKIGSNVLTRDDGTLNITRMSALVDQTAELHKQGIKIIIISSGAVASGRSEIKIE
KKLDSVLARQLYSSVGQAKLINHYYELFRNHGIVCGQVLTTKENFSSRSHYLNQKHCMEI
MLENKVIPIVNENDTVSVSELMFTDNDELSSLIVTMMKMNALIILSDVDGIYNGNPTDPN
ASVIREITEDKDISNYVQTTQSSFGRGGMQTKYRIAQKVADEGTTVIIANGQRENILLDL
LKTKNNVVHTQFKPAQKTISSVKTWIAHSEDFAKGKVYINKGATKALQETKAISILLVGV
TRIVGSFEKDDIVRIMDENGVQIGIGRSNYDSREATQYIGKHDMKPLIHYDYLYLE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctatcaaaatagggagtaatgtattaacacgcgatgatggtacatta
aatattacacgaatgtcagctttggtagatcaaacagcagagctacataaacaaggaatt
aaaattattataatttcttctggcgcagtagcttctggccggagcgaaattaaaatagaa
aagaaattggattctgttttagccagacaactctattcttcagtgggacaagctaagtta
attaatcactattacgagttatttcgtaatcatggtatcgtttgtggacaagtactcact
actaaagaaaattttagtagtcgttcgcattacctcaatcagaagcattgcatggaaata
atgttggaaaacaaagttattccaattgtgaatgaaaatgatactgtctccgtaagcgaa
cttatgtttactgataatgatgaactatcatctttaatagtcactatgatgaaaatgaat
gctttgatcattctcagtgatgtagacggtatttataatggtaatccaacagaccctaat
gcatcagttatccgagaaataacagaagataaagatatctcaaactatgtacaaactact
cagtcttctttcggacgcggcggaatgcagactaaataccgaattgcccaaaaagtggca
gatgaaggaactactgtcatcattgctaatggtcaacgtgaaaatatattactcgatttg
ttaaaaacaaagaataatgtagttcatacccaattcaaaccggcccaaaaaacaataagc
agtgtaaaaacgtggattgcccattctgaagactttgctaaaggaaaggtttatattaat
aaaggggcaacaaaggcactacaagaaacaaaagccattagtattcttttagtaggagtt
acccgtattgttggcagttttgagaaagatgatattgttcgcatcatggatgagaatggt
gttcaaataggcataggaaggtcaaattatgatagtcgagaggcaactcaatacataggt
aaacacgatatgaaaccattaatacattacgactatctttatctagaatag

DBGET integrated database retrieval system