KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_728Help
Entry
CFPG_728          CDS       T00792                                 

Definition
(GenBank) dipeptidyl-peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Brite
KEGG Orthology (KO) [BR:aps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aps01002]
    CFPG_728
Enzymes [BR:aps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     CFPG_728
Peptidases [BR:aps01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   CFPG_728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: BAG83991
UniProt: B6YS19
Position
complement(1065541..1067550)
Genome map
AA seq 669 aa AA seqDB search
MGKVITGVEKSKFDYNAERFADVDILRYRVEEWESLSLNQKKLLYCLSEAALQGRDIIFD
QNNRYNLAIRRVLEAIYSNYQGDILSKDYENFVIYMKKVWFYNGIHYHHYGEEKFLPGFS
KDFFVREVQSLDPFFVPMRKGQSVNNFLTEIIPVMFESSVYAKKVNQNSGLDVIATSANN
YYGEDITQVEVEQFYSAMKTSTNITPITYGLNSRLVKKNGFLTEEVYKIGGLYSSAIEQI
VYWLKEASQYAENRLQKRVILSLIEYYQTGCLEKYDEYAIQWVQDTVSRVDFVNGFIESY
GDSLGIKASWESIVNFKSLEATAFFQLISNNAQWFEDHSPVASQFKKKEVKGVSVKVITV
SILGGDCYPSTPIGVNLPNSDWIRKDYGSKSVIISNIIDAYDKASSGNGFIDEFVYGEQE
KKLIKQYGSRTDNLHTALHECLGHASGQLLPGVDSDVLRIYGSTIEEARADLFGLYYIPD
DKMLDLGLLPTPEAYKAEYYKFLMNGSITQLARIKLGKEIEEAHMRSRALISHYILDVGY
DEDIARLIRESGKTYVVINNYEKMRELIGKLLARIQRIKSEGDFNDAQYIVEKYAVLVDI
DLHKEILKRYAYLNISPYKGFINPVYTAVRDIKGNIIDVKISYNENYSEQMLRYSRDYSH
LPTYNEVAK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttattactggagttgaaaaaagcaaattcgattataatgcagagcgtttt
gctgatgtggatattttgcgttatcgagtagaagaatgggagagtctttccctgaatcaa
aaaaagttactttattgccttagtgaagcggctttgcaaggaagggatattatttttgac
caaaataatcgttacaatttagctattagacgggttttggaagctatttattctaattac
caaggtgatatactgagtaaggattatgaaaattttgtgatttatatgaaaaaggtttgg
ttctataatggtattcattatcaccattatggtgaagagaagtttttgcctggcttttct
aaagatttttttgtacgagaagttcaatctttagatcccttttttgttcctatgagaaaa
ggacaatcggtaaataactttcttacagaaataatacctgttatgtttgaatcaagtgtt
tatgctaaaaaagtaaatcaaaatagtggtcttgatgtcattgctacttctgccaacaat
tattatggtgaagatattactcaagtagaagttgaacaattttacagtgcaatgaagact
tctactaatattactcctattacttatggattgaatagccgtttggttaagaagaatggg
tttttaacggaagaggtgtataaaattggaggattatattcttcagctatagagcaaatt
gtttattggttgaaagaggcaagtcaatatgccgaaaataggctacaaaagagagttatt
ctttcattaattgaatattatcaaactggttgtttagaaaaatatgatgaatatgctatt
caatgggtacaagatacagtatcgagggttgactttgttaatggatttattgaatcttac
ggtgattccttgggtattaaagctagttgggaatccattgtaaattttaaatctttagaa
gctacggctttctttcaactcattagtaataatgcacagtggtttgaagatcattcacct
gttgcttcgcaatttaagaaaaaggaagtaaaaggtgtttctgttaaagtgattactgtt
tctatcttaggtggtgattgttatccttctactccgattggagtcaatttacctaattct
gattggatacgtaaggattacggttcaaaatctgttattatatccaatataattgatgct
tatgacaaagcatcctctgggaatggatttatagatgaatttgtttatggggaacaagaa
aagaaattgattaaacaatatggcagtcgaacagataatcttcacactgctttgcatgaa
tgtttaggacatgcttcggggcagcttttaccaggagtagattctgatgttttgagaatt
tatggttctaccattgaagaagcacgtgcagatctttttggtctttactatatccctgac
gataagatgttagatcttggtttgttacccacccctgaagcttataaagccgaatattat
aaatttctgatgaatggatctattactcaacttgctcgtatcaaacttggcaaagaaata
gaagaagctcatatgagaagtcgtgctcttatttctcattatattcttgatgttggatat
gatgaagatattgccagattgattagagaaagtggtaaaacttatgttgttattaacaat
tatgaaaaaatgcgtgaattgataggtaaattacttgcaagaatacaacgtattaaaagt
gaaggagattttaatgatgctcaatatatagttgagaaatatgcagttttggtagatatt
gatctacataaagaaatattgaaaaggtatgcctatttgaatatttccccttacaagggt
tttattaatcctgtttatacagctgttcgtgatataaaaggcaatattatagatgtgaaa
attagttataatgaaaattatagtgagcaaatgttgcgatattcacgagattattctcat
ttacctacttataatgaagtagctaaatga

DBGET integrated database retrieval system