KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_02240Help
Entry
APA01_02240       CDS       T00988                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00670  One carbon pool by folate
apt01100  Metabolic pathways
apt01120  Microbial metabolism in diverse environments
apt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    APA01_02240
Enzymes [BR:apt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     APA01_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR zf-CCCH_4
Motif
Other DBs
NCBI-ProteinID: BAH98376
UniProt: C7JBE9
Position
complement(237901..238650)
Genome map
AA seq 249 aa AA seqDB search
MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSWDAAALVRPQFGN
VIPHIRAIDIAPDAPLPGADQPGLEEILVVHGDPPADLSHRTYPNSTESIIRRYRREAPH
LKVYAAFDPYRRAPWKELEDVARKKEAGAIGFFTQPVFDLKLFDLCREWMQGECVFWGLS
PVIGPKSRSYWETTNHIVFPRDFSPTLDANIQFAQTVLKELAQEKGKAYLMPVRIKLEQY
LPALLDAVA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttctcgcctttcggttgagctaattccgcgttctgctgaggctctggctgca
gatgtagctacggttaaagccgcattccctgccgcagatacgctgaatattccggacctg
atgcgctttcccctccgcagttgggatgccgcagcacttgtgcgccctcagtttggaaat
gttattccgcatatccgggccatagatattgcgcccgatgcccctctgcccggggcagac
caaccggggttggaagagattctggtagtgcatggtgatccgccagcagatcttagccac
cgcacataccccaacagcacggaaagcattatccgccgctatcggcgtgaagcgccgcat
cttaaagtctatgcagcgtttgatccttaccgccgtgccccgtggaaagaactggaagat
gtggcccgcaagaaagaagccggagccattggttttttcacacagcccgtctttgacctg
aagctgtttgacctgtgccgggaatggatgcagggcgaatgcgtattctgggggctctcc
cccgttattggccccaaatcacgctcttattgggaaacaacaaaccacattgttttcccg
cgtgatttttctcctacgctggatgccaatatccagtttgcacaaacggttcttaaagaa
ctggcgcaggaaaaaggcaaagcctacctgatgccggtgcgcatcaagctggagcaatat
cttcccgctctgctggatgccgtggcataa

DBGET integrated database retrieval system