KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_05920Help
Entry
APA01_05920       CDS       T00988                                 

Definition
(GenBank) inorganic phosphate low-affinity transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Brite
KEGG Orthology (KO) [BR:apt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    APA01_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAH98742
UniProt: C7JDU8
Position
complement(610088..611701)
Genome map
AA seq 537 aa AA seqDB search
MSGTLLSPAAAPRPNMKGGTNQAFRMFFMGVVTAALVFVGYSVLADLRSAGENGMAIGAF
ALLALALLIALGFEFVNGFHDTANAVATVIYTNSLPPLVAVVWSGMWNLAGVLVSSGAVA
YSVVTLLPVELILQVGSGAGHAMIFALLLSAIIWNLATWAFGIPNSSSHALVGSILGVGF
ANQLMSPAGSALYGVDWSQVRKVFSALLFSPVCGFVLAAGMLILMRLVIRNAALYRAPEG
DAPPPLWIRGLLVGTCTGVSFFHGSNDGQKGMGLIMLILIGAAPTAYALNRAMPDDMMPA
FVQTAQQAAHVFEVHGSAAPSLPSAEEARAQVTDALRTKTVARPEIYSALGVLSDDIAQS
VGSYHSLQTIPAAAVPNVRTDMYLVAEAVRNMGKVSGFTGDESAELSKFMGQLNAGTRFI
PTWVKIAVALALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGAAAELVAMGTIGLAERYGL
PVSTTHILSSGVAGTMVAGGGGLQWATLRAMAMAWVTTLPAAMLISGVLYFIFRHIF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacgttgctgagtccggctgccgcaccacgccccaacatgaagggaggcacc
aaccaagccttccgcatgttctttatgggtgtggtgacggcagcccttgtttttgtaggg
tatagtgttctggcagacctgcggtctgctggtgaaaacggcatggccattggggccttt
gcactgctggctctggcgcttttgattgcgctgggctttgaatttgtaaacggctttcat
gatacggcaaacgccgtggccaccgttatttacaccaacagcctgcccccactggtggcg
gttgtgtggtctggcatgtggaaccttgctggcgttctggtttcatccggggcggtggct
tacagtgttgtcacacttctgccagtagagcttatcctgcaggttggcagcggtgccggc
cacgccatgatttttgccctgctgctttccgccattatctggaacctggccacatgggcc
tttggtattcccaacagctcctcccacgctctggtggggtccattctgggtgttgggttt
gccaaccagcttatgtctcctgccggtagcgccctgtatggggtggactggtctcaggta
cgcaaggtgttttccgccctgctgttctcccccgtttgcggctttgtgctggctgcgggc
atgttgatcctgatgcgtctggttattcgcaacgcggccctgtatcgtgcgccagaaggt
gatgccccgccgccgctgtggatccgtggtttgctggtgggcacctgcacgggtgtttcc
ttcttccacggcagtaacgatgggcagaagggcatgggccttatcatgcttatccttatt
ggtgcggctcccacggcgtatgcgcttaaccgcgccatgccagatgacatgatgcccgcc
tttgtgcagaccgcacagcaggccgcccatgtgtttgaagtgcacggctccgctgccccc
agcctgccaagtgcagaagaagcccgcgcacaggtaaccgatgcgctgcgcaccaaaaca
gtggcccgcccggaaatctattccgcccttggcgtgctgtctgatgatattgcacagtct
gttggcagctatcattccctgcagaccattccggctgctgctgtgccaaacgtgcgcaca
gacatgtatctggtggcagaagccgtacgcaacatgggcaaggtttccggttttacgggt
gatgaaagtgccgagctaagcaagtttatgggccagcttaacgcaggcacacgctttatt
cccacatgggttaaaattgccgtggcgctggctctgggccttggcaccatggtgggctgg
aagcgcattgttgtcaccgttggtgaaaaaattggcaaaacccatctgacctacgcacaa
ggtgcggcggcagaactggtagccatgggcaccattggcctggcagaacgctatggcctg
ccggtttccaccacgcacattctttccagcggtgtggctggcaccatggttgccggtggc
ggtggcctgcaatgggccaccctgcgcgccatggccatggcgtgggtgacaaccctgccc
gccgccatgctgatcagcggcgtgctttacttcatcttccgccacatcttctaa

DBGET integrated database retrieval system