KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_07050Help
Entry
APA01_07050       CDS       T00988                                 

Definition
(GenBank) bifunctional (proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase)
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00250  Alanine, aspartate and glutamate metabolism
apt00330  Arginine and proline metabolism
apt01100  Metabolic pathways
apt01110  Biosynthesis of secondary metabolites
apt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA01_07050
   00330 Arginine and proline metabolism
    APA01_07050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apt03000]
    APA01_07050
Enzymes [BR:apt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     APA01_07050
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     APA01_07050
Transcription factors [BR:apt03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    APA01_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: BAH98853
UniProt: C7JEM3
Position
complement(727394..731119)
Genome map
AA seq 1241 aa AA seqDB search
MSGGNNHYEAKTTCTHGRPGSGSPIRNEKPMSSTDTFAPDFASRTPLRQAIIEAMRRPEA
QCVETLTPDATLTEAQNGSVASMAAKLAEALRARRSPGLVETLVQEFSLSSTEGVALMCL
AEALLRIPDVATRDALIQDKIGESNWLSHVARGKPLFANAAAWGLALTGKLVTEHDEGTL
ASSLLNFAERTSKPIIRKAVDAAMRLMGEQFVLGQTIDQARKNSAKLEAVGFSYSYDMLG
EAAFTAHDAERYRQDYINAINTIGRSATGNNVYDRPGISIKLSALHPRYARAQYDRVMGE
LLPVVQELTLLARKYDIGLNIDAEETERLDVSLDILEALCATPGLEGWNGIGFVVQAYGK
RCPYVLDYIIDLARRTNRRIMVRLVKGAYWDSEIKKAQVEGMADFPVYTRKCHTDISYIA
CARKLLNARDVIFPQFATHNARTLSTIYTLAGEKFELGSYEFQCLHGMGEPLYKQVVGAD
KFNRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVNQIGDSAIPLSSLIENPIDVARCY
TPYGAPHTEIRNPRDLFAPERINSAGVDLADDKVLSALATGIKDAPQTWEASPMVVGVKK
KGAFRPVTNPADRRDVVGKVSYATPDVVRKAVDAAQKGQQDWANRSPAERADILQKASDI
LEERTDDLLALLGREAGKSLPNAVAEVREAVDFLRYYGATIRRDFDNTTHKPLGIVTCIS
PWNFPLAIFIGQIAAALAAGNVVLAKPAEETPLVAAVAVGILQEAGVPPAALQLLTGEGD
VGAAAVADERVMGVMFTGSTTVAQIINRQLLERRTATGQPVPFVAETGGQNAMIVDSSAL
AEQVVADVLASAFDSAGQRCSALRVLCVQEDCADHVLAMLRGAMRELRIGNPAHLSCDVG
PVITEEAAANITAHVNAFKARKAPVMALPVPEACANGSYVPPTLIEVLNIREIGPEVFGP
VLHVLRFERDKMEELLLEINDTGYGLTFGLHTRLDSTIKSVLSQVEAGNLYVNRNTIGAV
VGVQPFGGRGLSGTGPKAGGPLILRRLLSEAPTVAQIVRGRTMPEMAQWTDWLREKGESK
AAQIAGNLARLPLVGGEITLPGPVGEQNIYRLSARGNVLCVPITLAGLYDQISLALAGGN
TALVLAEEELTGWLDRLPDILRQAIRPVASATALPCSILLGEDDNAIFRSARRTLAEANG
PIVSAFVTGTTLPSVEVVLEEQSRSINTTAAGGNASLMTLN
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagggaataatcattatgaagccaaaactacctgcacacatggcaggcccggt
tctggctcaccaatccggaatgaaaagcccatgtcatccacagacacgttcgctcctgat
tttgcatcccgcaccccacttcggcaggccattattgaagccatgcgccgccccgaagcc
cagtgcgtggaaaccctgacaccagatgccacattaacagaggcgcaaaacggctctgtt
gccagcatggctgccaaactggccgaagccctgcgtgcgcgccgcagcccggggctggtg
gaaacactggtgcaggaattctcgctttcctctaccgagggcgtggccctgatgtgtctg
gcagaagcgctgctgcgtattccagacgttgccacgcgcgatgcgctgattcaggacaag
attggtgaaagcaactggctttctcatgtagcgcgcggcaagcccctgtttgccaacgcc
gccgcatgggggctggcgctgaccggcaagctggtgaccgagcatgatgaaggcacgctg
gccagctctctgctcaactttgcagaacgcacatccaaacccattatccgcaaggccgta
gatgccgccatgcgcctgatgggcgaacagtttgtgctgggccagaccattgatcaggcc
cgcaagaacagcgccaaactggaagccgtgggtttttcctattcctacgatatgctgggc
gaggccgcgtttaccgcgcatgatgctgaacgctaccggcaggattacatcaacgccatc
aacaccattggccgcagcgcaaccggcaacaatgtgtatgaccggcccggcatttccatc
aaactttctgccctgcacccacgctacgcccgcgcacagtatgaccgcgtgatgggcgaa
ctgctgccggttgtgcaggaacttacgctgctagcccgcaaatacgatatcggcctgaac
attgatgcggaagaaacagaacggctggatgtctctttagatattctggaagccctgtgc
gctacaccggggctggaaggctggaacggcattggctttgtggtgcaggcttacggcaag
cgctgcccctatgtgctggactacattattgatctggcccgccgcaccaaccgccgcatt
atggtgcgtttggtaaaaggtgcttactgggatagcgaaatcaagaaagcacaggttgaa
ggtatggcggattttcccgtttatacccgcaagtgccacacggatatcagctacattgcc
tgcgcccgcaaactgctgaacgcacgagatgtcatcttcccgcagtttgccacgcacaac
gcccgcacgctttccaccatttacacactggcgggtgaaaaattcgagcttggctcttac
gaattccagtgcctgcatggcatgggtgaaccgctgtacaaacaggttgtgggggcagac
aagttcaaccgtccatgccgcatttatgcacctgttggcacgcatgaaaccctgctggcc
tatcttgtgcgccgccttttggaaaacggagccaattcctccttcgtcaatcagattggg
gatagcgccattccgctttcatccctgattgaaaaccccattgatgtggcccgctgttac
acaccttacggcgcaccgcacacagaaatccgcaacccgcgtgatctgtttgcgccagaa
cgcatcaactccgcaggggtggatctggcggatgacaaggttctgtccgcactggcaacc
ggcattaaggatgctccgcaaacgtgggaagccagccccatggttgtgggtgtaaaaaag
aaaggcgctttccgccccgttaccaacccggcagaccggcgcgatgtggtgggcaaggtc
tcctacgccacgccagatgttgtgagaaaagcggtggatgccgcacagaaaggccagcag
gactgggccaaccgcagcccggcagaacgcgcagacattctgcaaaaggcctctgacatt
ctggaagaacgcacagatgatcttctggcacttctggggcgtgaagcgggcaaatccctc
cccaacgccgtggcagaagtgcgtgaggctgtagacttcctgcgctattacggcgccacc
atccggcgtgattttgataacaccacccacaagccactgggaattgttacctgcattagc
ccgtggaacttcccgctggccatctttatcggtcagattgccgcagcccttgctgccggt
aacgttgtgctggccaaaccggcggaggaaacaccccttgttgccgccgtggccgtgggc
attttgcaagaggcaggcgtgccccccgcagccctgcaactgctgactggtgaaggtgac
gtaggcgctgccgccgtggcagatgagcgcgtaatgggcgtgatgttcaccggttccacc
accgtggcgcagattatcaaccgtcagcttctggaacggcgcacagccacaggccagccc
gtgccatttgtggccgaaaccggcggccagaacgccatgatcgtggattcctccgcactg
gcagaacaggttgtggccgatgttctggcctctgcctttgatagtgcaggccagcgctgt
tccgccctgcgtgttctgtgtgtgcaggaagattgtgcagatcacgttctggccatgctg
cgtggcgccatgcgtgagctgcgcattggcaaccccgcgcatctttcctgcgatgtgggc
ccggtgattaccgaggaagctgctgccaacattaccgcgcatgttaacgcctttaaggcc
cgcaaagccccggttatggcgctgcctgtgccagaagcctgcgccaacggcagctacgtg
ccacccacgctgattgaagtgctgaacattcgggaaattgggccagaagtgtttggcccc
gtgctgcatgttttgcgctttgagcgtgacaagatggaagaactgctgctggaaattaac
gataccggctacgggctaacattcggcctgcacacccggttggattccacaatcaaaagc
gtgctctctcaggttgaggctggtaatctttacgtcaaccgcaacaccattggcgcggtt
gtaggcgtccagccttttggtgggcgcggcctttctggcactggccccaaggcgggtggc
ccgcttattctgcgccgtctgctgtccgaagccccaaccgtggcgcagattgtgcgtggc
cgcaccatgccagaaatggcgcagtggacagactggctgcgtgaaaagggtgaaagcaaa
gccgcgcagattgctggcaatctggcacgcctgccgctggtgggcggagaaatcaccctt
cccggccctgtgggtgagcagaacatctaccgcctgagcgcacgcggcaacgtgctgtgt
gtgcctatcacgctggccgggctgtatgatcagatctctctggcactggctggtggcaac
accgcactggtgctggcagaagaagaactgacaggatggctggatagactgccagatatt
ctgcgccaggctattcgcccggttgccagcgcaacggccctgccctgctctattctgctg
ggagaagatgataacgccatcttccgcagcgcacgcagaacactggcagaagccaatggc
cccattgtttccgcctttgtaacgggcacaacattgccttctgttgaagtggtgctggaa
gagcagtcccgcagcatcaacaccaccgcagcgggtggcaatgccagcctgatgacactg
aactaa

DBGET integrated database retrieval system