KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_16060Help
Entry
APA01_16060       CDS       T00988                                 

Definition
(GenBank) serine palmitoyltransferase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00780  Biotin metabolism
apt01100  Metabolic pathways
Module
apt_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:apt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APA01_16060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apt01007]
    APA01_16060
Enzymes [BR:apt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     APA01_16060
Amino acid related enzymes [BR:apt01007]
 Aminotransferase (transaminase)
  Class II
   APA01_16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAH99738
UniProt: C7JBJ4
Position
1738646..1739860
Genome map
AA seq 404 aa AA seqDB search
MTSLFSKFEGTAGALGSVVAVGGRNPFAVVIEKPVSSTVGIIEGRETLLFGTNNYLGLSQ
SKNAIRAAQEAAAACGVGTTGSRIANGTQSLHRQLEKDIAAFFGRRDAMVFSTGYQANLG
IISTLAGKGDHLFLDADSHASIYDGSRLSAAEVIRFRHNDPDNLYKRLKRMEGTPGAKLI
VVEGIYSMTGNVAPIAEFVAVKKETGAYLLVDEAHSFGVLGENGRGAAEADGVEADVDFI
VGTFSKSLGTVGGYCVSDHPELEFVRLNCRPYMFTASLPPEVIAATTAALGDMQAHPELR
KQLMANAQQLHAGFVDIGLNASKQATPVIAVTLETAEEAIPMWNRLLELGVYVNLSLPPA
TPDSRPLLRCSVMATHTPEQIAQAIAIFRQAAAEVGVSPAATAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatcactattttccaaatttgaaggtacggcaggcgcgctgggttctgtagtcgcc
gttggtggccgcaacccttttgctgttgttattgaaaaacctgtatcttcaactgttgga
attattgaaggtcgggaaacgcttctttttggtaccaataattatttgggccttagccaa
tccaaaaacgctattcgagcagcgcaggaagcagctgctgcgtgtggcgtaggcactacg
ggctcgcgcattgcaaatggtacgcaatccctccatcggcagcttgaaaaagatattgcc
gcattttttggccgccgtgatgccatggttttttcaaccggttatcaggccaacttgggc
atcatttccactctggctggcaagggcgatcatctgtttttagatgcagatagccatgcc
agtatttacgatggcagccgcctaagtgctgctgaagtgatccgcttccgccacaatgac
ccggataacctttataaacgtcttaaacgcatggaaggcacacccggtgccaaactgatt
gtggttgaaggtatttattccatgacgggcaatgtggccccgattgcagaatttgtagcc
gttaaaaaagaaaccggcgcataccttctggtagatgaagcccactcctttggtgtgttg
ggtgaaaacggacgcggtgcggctgaagctgatggtgtggaagctgatgtagactttatt
gtcggcacattctcaaaaagccttggcactgttggtggctactgcgtatccgatcatcct
gaactggaatttgtacgtctgaactgccgcccttacatgtttacggcgtcccttccgcca
gaagttattgcggcaacaacggctgccttgggcgatatgcaggcgcatccagaactgcgt
aaacagcttatggccaatgctcagcaacttcatgccggttttgtagatatcgggctaaat
gccagcaaacaggccacccctgttattgctgttacactggaaacggctgaagaagctatt
cccatgtggaacagactgctggagcttggtgtgtacgtaaacctcagccttcctccggca
acgcctgattctcggcctttgctgcgttgttctgtaatggccacccatacgccagagcaa
attgctcaggctattgccatattccggcaagctgccgcagaagtaggcgtatcccccgcg
gctaccgcagcataa

DBGET integrated database retrieval system