KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_19860Help
Entry
APA01_19860       CDS       T00988                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:apt00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    APA01_19860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apt01011]
    APA01_19860
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:apt03036]
    APA01_19860
Enzymes [BR:apt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     APA01_19860
Peptidoglycan biosynthesis and degradation proteins [BR:apt01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   APA01_19860
Chromosome and associated proteins [BR:apt03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    APA01_19860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3
Motif
Other DBs
NCBI-ProteinID: BAI00109
UniProt: C7JD97
Position
complement(2168489..2169388)
Genome map
AA seq 299 aa AA seqDB search
MAFQADKMDGKTVTSAAVQKGVTRRSGLLYLGGGGLVAASVPVNVWAASKQATAHKLAAP
AIIGNARPTAPLVMLDPGHGGKDPGAIGYTGTYEKHVAEAAAQELKRQLLATGRYRVAMT
RAGDHFVPLDGRVELAQQHGASLFISMHADALHSPQVRGASVYTHSHGASDSQTADLAKT
ENSADRYGGPMVHSASPEVQQILASLVTEETRKGSAHMAQAVVSAFNSRVLLLPHPHRHA
AFAVLKSAQIPSVLVEMGFMSNRMDEAALRQAGHRAMVAGAMRDAVNRYFASAGVGLAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcaggcagacaagatggacggcaaaactgttacttctgcagcggtgcagaag
ggcgtaacgcgccgttccggcctgctgtatttgggtggtggcggacttgttgctgcaagt
gtacctgtaaatgtttgggctgcaagtaaacaggcaacggcacataagctggctgctccg
gctattattggcaacgcacggcctacagcgccgcttgtgatgctagaccccgggcatgga
ggtaaagacccaggcgccattgggtacactggtacatatgaaaagcatgtagcagaagca
gccgcgcaggaattgaagcggcaattgttggcaacaggccgttaccgcgtagccatgacg
cgtgccggagaccattttgtgccgctggatggccgtgtggagttggcgcagcagcacgga
gcatcgcttttcatttccatgcatgcagatgccttgcacagcccgcaggtgcgtggcgca
agtgtttatacccattcgcacggtgcatcagacagccagacagcagatttggccaagact
gaaaacagcgcagaccgatatggtgggccaatggtgcatagtgcatcgccagaggtgcag
cagattcttgccagtctggtaacggaggaaacccgtaaagggtcagcccatatggcgcag
gctgtggtgtccgccttcaattctcgggtgttgttgttgccgcatccacataggcatgcg
gcttttgctgtgttgaagtctgcccaaattccctcggttctggttgaaatgggctttatg
tcaaaccggatggatgaggccgcgttgcgtcaggcaggccaccgggccatggtggccggg
gccatgcgagacgccgttaatcgttattttgcgtcagccggggttgggttggcaggctga

DBGET integrated database retrieval system