KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_26150Help
Entry
APA01_26150       CDS       T00988                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00790  Folate biosynthesis
apt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APA01_26150
Enzymes [BR:apt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     APA01_26150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: BAI00712
UniProt: C7JGX7
Position
complement(2833955..2835043)
Genome map
AA seq 362 aa AA seqDB search
MERGGRNVASFRLGRADEMTYARLIEPLGLVYGSIAQAAIKQGDALPLYGGPAAFTFVRL
IEGYQTAGLMSVQKVPQDWAPELERITRSVPPVGLPTGTQIMGILNITPDSFSDGGELAS
IDKAVLKAHGMVRAGATVLDIGGESTRPGAVTVTPEEEWQRVGPVLAALKAELPNVAISV
DTRNSYVMQRALAAGAHIINDVTALAYDAAALPLLASQDCGVVLMHMRGTPQTMAQHAVY
EDVSVDVVRELAQRIEVAVKGGIARHRIMVDPGFGFAKNFEQNKELLRHILLLANLGCRV
VFGVSRKRMIGNLTGETTPHLRDAGTQAASFPAMALGNPVLRVHDVTGMMQAVNVWREIY
QI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagaggcggcagaaatgtcgcctcttttcgtttgggaagagctgatgaaatgacg
tatgcgcggctgattgaacccttggggcttgtttatggcagtatagcgcaagcagctatc
aagcagggtgatgctttacctttgtatggtggtccggcggcatttacgtttgtgcgtttg
atagaaggctatcaaacagcaggtttaatgtctgtacagaaagtgccgcaggactgggct
ccggagcttgagcggataacacgttctgtaccgccagtgggtttgcctacaggtacccag
atcatgggtatcctgaatatcacgcccgatagttttagtgacggcggtgaactggcaagt
attgataaggctgttttaaaggcacacggaatggtgcgggctggcgcaaccgtgctggat
attgggggagaaagcacacgccccggtgcggtcacagtaacaccagaagaagaatggcaa
cgtgttggcccggttcttgctgccctaaaggcagaactgcctaatgtggctatttctgta
gatacgcggaacagttatgtcatgcagcgcgctttggctgctggagcacatattatcaac
gatgtaactgcccttgcgtatgatgctgcggctttgccgcttctggcctcacaagattgc
ggtgttgtgctcatgcatatgcgcggcacaccacaaactatggcgcagcatgccgtgtat
gaagatgtaagtgtagacgtggtgcgtgaactcgcacaacggattgaggttgccgtaaaa
ggtggcattgcaagacatcggattatggttgatccgggatttggttttgcaaaaaacttt
gagcagaataaggagctattgcggcatattctgctactggccaacttgggctgtcgggtt
gtatttggcgtttctcgcaagcggatgatcggcaaccttactggtgaaactacaccgcat
ttgcgggatgcaggaacgcaggcggcatcctttcctgctatggcattaggtaacccggtt
ttgcgcgtgcatgatgttacgggcatgatgcaggctgtaaacgtgtggcgggaaatatat
cagatctaa

DBGET integrated database retrieval system