KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_00320Help
Entry
APA07_00320       CDS       T01813                                 

Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
apu00020  Citrate cycle (TCA cycle)
apu00190  Oxidative phosphorylation
apu00650  Butanoate metabolism
apu01100  Metabolic pathways
apu01110  Biosynthesis of secondary metabolites
apu01120  Microbial metabolism in diverse environments
apu01130  Biosynthesis of antibiotics
apu01200  Carbon metabolism
Module
apu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA07_00320
   00650 Butanoate metabolism
    APA07_00320
  Energy metabolism
   00190 Oxidative phosphorylation
    APA07_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS CPT
Motif
Other DBs
NCBI-ProteinID: BAI04288
Position
29110..29523
Genome map
AA seq 137 aa AA seqDB search
MNASAPHIEVMRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLSTWFVVQMFRLGGADH
TEVVKWGGKPVNATMLIALIITTFYHAQLGLQVIVDDYVHGKAHLPTRLLVKIGTSLLGL
LGVIAVIKLFVRGSTAK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttctgctcctcatattgaagtcatgcgctcccagcttgggcgggcacgcggg
ctcggggccgggcattccggtgtaggccattggtgggccgaacgtgtaacggcagcttcc
ttgcttccactttcaacgtggtttgtggtgcagatgttccgccttggcggcgcagatcat
acagaagtggtgaagtggggcggcaagcccgtaaacgcgaccatgctgatcgccctgatc
atcaccactttctaccatgctcagcttgggctgcaggtcattgtggatgattacgtgcac
ggcaaggcgcatctgcctacccgcttgcttgttaaaatcggtacctccttgttggggctg
ctgggcgtaattgccgttatcaagctgtttgtgcgcggtagcactgccaaataa

DBGET integrated database retrieval system