KEGG   Atopobium parvulum: Apar_0656
Entry
Apar_0656         CDS       T00983                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
apv  Atopobium parvulum
Pathway
apv00620  Pyruvate metabolism
apv00640  Propanoate metabolism
apv00650  Butanoate metabolism
apv01100  Metabolic pathways
apv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Apar_0656
   00640 Propanoate metabolism
    Apar_0656
   00650 Butanoate metabolism
    Apar_0656
Enzymes [BR:apv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Apar_0656
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACV51085
UniProt: C8WAE7
Position
complement(731785..733941)
AA seq 718 aa
MQETPAQEAWDGFVGGNWQKAIDVRDFIQRNYTPYDGDDSFLAGPTEATTKLWADVMDLF
AQETANGGVLDMDTKLVSTITSHEAGYIEKPLEQIVGLQTDKPLKRALMVDGGIRMAMAA
CKAYGYEVDPEIVNFYTYRRKTHNAGVFDVYTEEMRKCRHSHIITGLPDAYGRGRIIGDY
RRVALYGVDALIADKTNQKNGTGSIMDEKTIRHREELSEQIRALKELKQLGEIYGFDLGR
PAENFKEAVQWLYLGYLAAVKEQNGAAMSIGRNTTFLDIYAERDLARGTFTESEIQEIVD
HLVMKLRMVKFARTPEYNELFSGDPQWVTESIGGIGIDGRSMVTKSSFRWLHTLENMGTS
PEPNLTVLWSTKLPVGFKRYCAKISITTSSIQYENDDLMRVYHGDDYAIACCVSSMRIGK
EMQFFGARANLAKCLLYAINGGRDEKTGEQIGPKYRAVEGEYLDYDDVFSKYMDMMRWLA
GVYVNALNAIHYMHDKYSYERIQMALHDEHVHRWFATGIAGLSVVADSLSAIKYAKVRVV
RDETGLVTDYIIEGNFPKYGNDDDRVDTIAHDIVEIFMKMIRQNHTYRDSVPTTSILTIT
SNVVYGKATGNTPDGRRAGVPFAPGANPMHRRDTYGAVASLASVAKLPFNDAQDGISNTF
SIIPNALGKGSDVYFHGSELNLDHIDFSDMNLDIQIENKIDCACEADPSAAEGAEDRK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgcaggaaacaccagcacaggaggcttgggacggctttgtcggtggtaactggcaaaaa
gcaattgacgtccgagacttcatccagaggaattacaccccttacgatggtgatgattcc
ttcctcgctggtccaactgaagctactacaaagctttgggcggatgttatggatcttttt
gctcaagaaaccgcaaatggtggcgtacttgatatggataccaagctggtttccactatc
acttcccacgaggctggctacattgagaagccacttgagcagattgtcggccttcaaacg
gacaagccacttaagcgcgcccttatggtagacggtggcattcgtatggcaatggctgcc
tgcaaggcatatggatacgaggttgacccagagattgttaacttctacacctatcgtcgc
aagactcacaacgctggcgtttttgatgtctataccgaggaaatgcgtaaatgccgtcac
tcccacatcatcactggtctgcctgacgcatatggccgtggccgcatcatcggcgattat
cgtcgtgttgcactttacggcgttgatgctcttattgcagacaagacaaatcagaaaaat
ggcaccggctccatcatggacgagaagaccattcgtcatcgcgaagagctctctgagcag
attcgtgcgctcaaagaacttaagcagcttggtgagatttacggctttgatttgggccgt
cctgctgagaacttcaaagaggctgttcagtggctctacctgggttatcttgccgctgta
aaagagcagaatggcgctgcaatgtccattggtcgcaacaccaccttcttggacatctat
gcagagcgcgatcttgctcgtggtaccttcactgaatctgagattcaggagattgttgat
cacctggttatgaagcttcgcatggtcaagtttgcccgtacccctgagtacaacgagctc
ttctccggagaccctcagtgggtcactgagtccattggtggcattggcattgatggccgc
tctatggttaccaagtccagcttccgctggctccacactcttgaaaacatgggtaccagc
ccagagcctaatctgactgttctgtggtccaccaagcttccagttggcttcaaacgctac
tgcgcaaagatttctattaccaccagctccatccagtatgagaacgatgatcttatgcgc
gtttatcatggcgatgactacgcaattgcttgctgcgtcagctccatgcgcattggtaaa
gagatgcagttctttggcgctcgtgcaaaccttgctaaatgtcttctttacgcaatcaat
ggtggtcgtgacgagaagaccggcgagcagattggtcctaagtatcgtgcagttgaaggc
gagtatcttgattacgacgatgtcttctctaagtatatggacatgatgcgctggcttgca
ggcgtttacgtcaacgctcttaatgcaatccactacatgcacgataagtacagctacgag
cgcattcaaatggctctacacgatgagcacgttcatcgctggtttgcaacaggcattgca
ggactttctgttgttgctgactccctctctgcaatcaagtacgcaaaggtaagggttgtc
cgcgatgagactggtcttgtcaccgattacattattgagggaaacttccctaaatacggt
aacgatgatgaccgcgttgacactattgctcatgacatcgttgagatcttcatgaagatg
attcgtcagaaccacacctaccgcgattccgttccaaccacttctatcctgaccattacc
tctaacgttgtgtatggtaaagctaccggcaacacccctgatggtcgtcgcgctggtgtt
ccttttgctcctggtgctaacccaatgcaccgacgtgacacttatggcgcggttgcatct
ctagcctccgttgctaagcttccattcaacgacgcacaggacggtatatccaataccttc
tcaatcattcctaatgctcttggtaagggctctgatgtctacttccacggcagtgagctt
aaccttgaccacatcgacttctctgacatgaatcttgacattcagattgagaacaagatt
gattgcgcctgtgaggcagatccatccgcagctgaaggtgctgaggatcgtaaataa

DBGET integrated database retrieval system