KEGG   Atopobium parvulum: Apar_0043Help
Entry
Apar_0043         CDS       T00983                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
apv  Atopobium parvulum
Brite
KEGG Orthology (KO) [BR:apv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Apar_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACV50480
UniProt: C8W8P2
Position
48392..49387
Genome map
AA seq 331 aa AA seqDB search
MVSILLIAVLIAAVVFEFINGFHDTANAIATTVYTKALPLRVAILMSATMNFIGALMSEK
VAMTIASGLVDIQLQLYVVFAALVGAIVWDLFTWWFSIPSSSSHALIGSLIGATIIFTRT
TNHIMWEGVLEKVVIPLFTSPLIGMALGYFIMKLVFELFADWPPKKAHGLFHRLQVLSAA
FMAYSHGNNDAQKTMGIITLALVTAGLHDPSMGIPLWVKLLCATTMALGTSIGGGRIMRT
VGDGVTKLTPVIGFVAEASSTVAIELMTAMGAPVSTTQVITTSIMGAGSARRRSSVRWGV
ARKIIAAWFITLPATMALGGLIAFLTSFVLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggttagtattttgcttattgcggttcttatcgccgcagttgtttttgagtttattaat
ggctttcatgataccgctaacgcaattgctaccacggtgtataccaaagctctgccgttg
cgcgttgctattttgatgtcggcaaccatgaattttattggtgctttgatgagcgagaaa
gtggctatgactattgcgtctggtcttgtcgatattcaattgcaactgtatgttgttttt
gctgcattggtgggagctattgtttgggacttgtttacctggtggttttcaattcctagt
tcttcctcacatgctttaattggtagtttaattggtgcaaccattatatttacaagaact
acaaaccatattatgtgggagggcgttttagagaaagttgttattcctctatttacttca
ccccttattggtatggctcttggttactttattatgaagcttgtctttgagctctttgcc
gattggccgcccaagaaagcacacggtctgttccaccgtcttcaggttctctcggctgca
tttatggcttacagtcatggtaacaacgatgctcagaaaaccatgggtattattaccctt
gcgctggtaaccgctggtcttcatgatccatctatgggcatccctttgtgggttaagttg
ctttgcgcaacaactatggctctgggtacttctatcggtggtggccgcattatgcgtacc
gttggcgatggcgtaactaagctcactccagttattgggtttgttgcggaggcaagttct
acggttgctattgagcttatgactgctatgggtgcgcctgtttctactacgcaggtcatt
acaacttctattatgggtgctggatctgctcgtcgacgtagttctgtccgttggggagtg
gcacgaaagattattgctgcatggtttattaccttgccagctactatggctctcggtgga
cttattgcttttttgaccagctttgttttggcataa

DBGET integrated database retrieval system