KEGG   Atopobium parvulum: Apar_0922Help
Entry
Apar_0922         CDS       T00983                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apv  Atopobium parvulum
Pathway
apv00010  Glycolysis / Gluconeogenesis
apv00051  Fructose and mannose metabolism
apv01100  Metabolic pathways
apv01110  Biosynthesis of secondary metabolites
apv01120  Microbial metabolism in diverse environments
apv01130  Biosynthesis of antibiotics
apv01200  Carbon metabolism
apv01230  Biosynthesis of amino acids
Module
apv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0922
   00051 Fructose and mannose metabolism
    Apar_0922
   00562 Inositol phosphate metabolism
    Apar_0922
Enzymes [BR:apv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Apar_0922
Exosome [BR:apv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Apar_0922
  Exosomal proteins of bladder cancer cells
   Apar_0922
  Exosomal proteins of melanoma cells
   Apar_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DrsE
Motif
Other DBs
NCBI-ProteinID: ACV51351
UniProt: C8W7B1
Position
complement(1035193..1035960)
Genome map
AA seq 255 aa AA seqDB search
MRNRMIAGNWKMNETFAEGIELAQGIVDQLASGTGNVDVVVAPPLVDLKGVSEVLTQANS
SVALSAQNVYWEESGAFTGETSPAMLTSVGATYCIIGHSERRGYFGETDEDINRKAKALM
AHDIVPISCCGESLEVRNAGTHVQFVVDQIKADTKGLEITDPSKYVIAYEPIWAIGTGMT
ATADDAQEVCGAIRKTLVEIFGAEIAEGIRILYGGSAKPENVGGFLEKEDVDGALVGGAS
LKADSFVAMVKSAMN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcgtatgattgcaggtaactggaagatgaatgagaccttcgctgagggcatt
gagcttgctcagggaatcgtcgatcagcttgcttccggtaccggaaacgttgacgttgtt
gttgctccacctcttgtagaccttaagggtgtctccgaggttcttactcaggcaaactct
tctgttgctctttctgcacaaaatgtgtattgggaggagtctggcgcatttactggtgaa
acctctccagcaatgctgacttctgttggtgcaacatactgcatcattggtcactctgag
cgtcgcggttactttggtgagaccgacgaggacattaaccgcaaggcaaaggcactgatg
gctcatgacatcgttcctatttcttgctgcggtgagtctcttgaggtccgtaatgctggc
actcacgttcagtttgttgttgatcagattaaggcagacaccaagggtcttgagattacc
gatccttccaagtacgtaattgcttatgagccaatctgggcaattggtactggtatgact
gcaactgctgatgacgcacaggaagtttgcggcgcaatccgtaagaccctggtagagatc
tttggcgcagaaattgcagagggcatccgtattctttacggtggctctgcaaagccagag
aacgttggtggcttcctcgagaaagaggacgtcgacggcgcacttgttggtggcgcatct
cttaaggctgattcttttgttgcaatggtaaagagcgctatgaactaa

DBGET integrated database retrieval system