KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_03160Help
Entry
APA42C_03160      CDS       T01818                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00230  Purine metabolism
apw00250  Alanine, aspartate and glutamate metabolism
apw01100  Metabolic pathways
Module
apw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    APA42C_03160
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA42C_03160
Enzymes [BR:apw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     APA42C_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: BAI16756
Position
329790..331079
Genome map
AA seq 429 aa AA seqDB search
MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGNQVYKLSLLPSGVV
NNKLGIIGNGVVVDPQALLAEIGRIQEQGLEVTPDTLKIAENAPLILPVHGALDRAREAA
RGDRKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDELLLHHNTLLAGLGAPVF
TKEELLKFLTDIAPKVLPYMAPTWDILDDARRAGRRILFEGAQAVMLDVDHGTYPFVTSS
NTVAANAGTGSGMGPTAAGFVLGIAKAYCTRVGEGPFPTELHDETGRRLGERGHEFGTNT
GRPRRCGWFDSVLVRHAVRVGGVNGLALTKLDVLDGLDEIRICVGYELDGQKIERFPSAP
AAQQRVRPVYETLEGWKETTHGARRWADLPAQAIKYVRRIEELVGAPVTLLSTSPDRDDT
ILMRDPFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtaaccgtgattggcgcccagtggggtgatgaaggcaaaggcaaaatcgta
gattggctagccagtcgggccgatattgttgtgcgctttcagggtgggcacaatgccgga
catacgctggttgtgggcaatcaggtttacaagctttccctgctgccttctggcgtggtg
aacaacaagctgggcattattggcaatggcgtggtggtggacccacaggcgctgctggca
gaaattggccgtattcaggaacaggggctggaagttacgcccgatacgctcaagattgca
gaaaatgcccctctgattctgcctgtgcacggtgcactggatcgcgcgcgtgaggctgcg
cgtggtgatcgtaaaattggcaccacgggccgtggcattggcccagcgtatgaagataag
gtggcccgccgcgctatccgcctgtgtgatctggccgagccagaaacgctggactggaag
ctggatgaactcctgctgcatcacaacaccctgctggcagggctgggtgcacccgtattc
accaaagaagaacttcttaaattcctgacagatatcgcccctaaagtgctgccttatatg
gcacctacatgggacattctggatgatgcccgccgtgcaggtcgccgcattctgtttgaa
ggtgcgcaggctgtcatgctggatgtggaccatggcacctatccatttgttaccagttcc
aacacagttgccgctaatgctggcacgggttcaggcatgggcccaacggctgcgggtttt
gttctgggtattgccaaggcgtattgcacccgtgtgggtgaaggtccgttccccacagaa
ctgcatgatgaaacaggccgccgccttggcgaacgtgggcatgaatttggcaccaacacg
ggccgcccgcgccgttgtggctggttcgattccgtactggtgcgtcatgccgtgcgcgtt
ggtggtgtaaacggtctggcgcttaccaagctggatgtgctggatggtctggatgaaatc
cggatttgcgttgggtatgaactggacggccagaagatcgaacgcttcccgtccgctccg
gcagcgcagcagcgtgtgcgcccggtttatgaaacgctggaaggctggaaggaaaccacc
catggtgcacgccgctgggcagacctgccagcgcaggccattaaatacgtgcgccgtatt
gaagaactggtgggcgcacctgttaccctgctttccaccagcccggatcgggatgacacc
attctgatgcgcgacccgtttgaagattga

DBGET integrated database retrieval system