KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07080Help
Entry
APA42C_07080      CDS       T01818                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00010  Glycolysis / Gluconeogenesis
apw00620  Pyruvate metabolism
apw00640  Propanoate metabolism
apw00680  Methane metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA42C_07080
   00620 Pyruvate metabolism
    APA42C_07080
   00640 Propanoate metabolism
    APA42C_07080
  Energy metabolism
   00680 Methane metabolism
    APA42C_07080
Enzymes [BR:apw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APA42C_07080
Lipid biosynthesis proteins [BR:apw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APA42C_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAI17144
Position
733137..735059
Genome map
AA seq 640 aa AA seqDB search
MVDAFFPATDNPVSDRYQDLVQRAQRDPEEFWLAQAQRLAWHTQPMHASRSDFTGDVRVS
WYEDGRLNAAENCLDRHVLYQPDNAALIWQGQEDGHREVLSYRELHARVCRLGNVLRRLG
VKKGDRVAIHLPMVAEGVISMLACARIGAVHVVLFGGFSAEGLAERLTDSGAVVVITADV
ARRGPKKIPSKTTMDEAIKLCGAQSAVRNVLVVPVTGADVPMQKGRDLSYTAEVALEIPD
CPPEVMNACDPLFLLYTSGSTGRPKGLVHSTGGYLVWASFTQELVFDAKPSDVFWCTADT
SWITGHTYVVYGPLVNGGTILVYEGLPSWPQPGRWWDVIDQNQVSVFYTSPTVIRAAMRE
DDSVVQSRSLSSLRVLGTVGEPISPEAWKWFYAEVGRNACPVVDTWWQTETGGVMITACA
QNVAAKPGAAGLPLPGVAATLTDTKGQDIEGEGEGLLCLAQSWPGQAMTLWQDHERFRKT
YFTTCPGHYFSGDGARRDATGYYWITGRVDDVVNVSGHRIGTAEIEDAVAEDHAVVESAA
VGVPHDLKGQALVVFVVPKAEGAFDATAVNKAVAAGVGRYAVPEKIYVVPDLPKTRSGKI
VRRLLRKIAANDLENMGDLSTLADPDIVAELIKLVAQQNG
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtggtagatgcgtttttccccgcaacggataaccccgtttctgatcggtatcaggatctt
gtgcagcgggcgcaacgtgatccggaggaattctggctggctcaggcgcaaaggctggca
tggcatacgcaacccatgcacgcatctcgctctgactttaccggcgatgtgcgggtttcc
tggtatgaagacgggcggctgaatgcggctgaaaactgtctggaccggcacgttctgtat
cagcccgataatgctgccctgatctggcaggggcaggaagacggccaccgcgaggtgctc
tcataccgtgaactgcatgcccgcgtctgccgcttgggcaatgtgctgcgccgtttgggt
gtaaaaaagggagaccgcgtggccatccatctgcccatggtggcagagggtgttatttcc
atgctggcctgcgcccgtattggggccgtgcacgtggtgctgtttggtggtttttctgcc
gagggtctggcagaacgtttgacagatagcggcgctgtggtggtgattaccgcagatgtg
gcgcgccgcgggcccaagaaaattcccagcaagaccacaatggatgaggccataaaattg
tgcggggcacaaagtgccgtgcgcaatgtgctggtggtgcctgtaacgggtgctgatgtg
cccatgcaaaaggggcgggacctgtcctacacagcagaagtagcgcttgaaataccggat
tgcccgccagaagtgatgaacgcgtgtgatccgctgtttctgctttacacatccggcagc
acgggccgccccaaagggctggtgcacagcacgggcgggtatctggtgtgggcgtctttc
acacaggagctggtgtttgatgccaaacccagtgatgtgttctggtgtacggcagataca
agctggattaccggccacacctatgttgtgtacgggccgctggtaaatggtggcaccatt
cttgtgtatgaaggcctgccatcatggccacagcccggccgctggtgggatgtgatagac
cagaaccaggtttcggttttctatacgtctcccacagttattcgcgctgccatgcgtgag
gatgattccgtggtgcaaagccgctctctgtccagcctgcgtgtgctgggtacggtgggt
gagcctatcagcccggaagcatggaagtggttttatgcagaagtagggcgcaatgcctgc
ccggtggtggacacatggtggcagacagaaaccggcggtgtgatgattaccgcctgcgcc
cagaatgttgctgctaagccgggagccgcagggctgcctttgccgggtgtggccgctacg
ctgacagataccaaagggcaggatattgaaggcgagggcgaaggcctgttgtgccttgcg
caatcctggcccggacaggccatgacgctgtggcaggaccacgaacggtttcgcaaaacc
tatttcaccacatgcccgggccattatttctcgggtgatggcgcacgacgggatgccacc
ggttattactggattaccggccgcgtggatgatgtggtgaacgtatctggccaccgcatt
ggcacggcagaaattgaagatgccgtggccgaagatcatgccgtggtggaaagtgccgcc
gttggcgtgccgcatgatctgaaagggcaggcccttgtggtgtttgtggtgcccaaggcg
gagggcgcgtttgatgccacagccgtaaacaaggccgtggccgcaggcgtgggccgctat
gcggtgccagaaaaaatttacgtggtgccggatctgcccaaaacacgttcgggcaaaatt
gtgcggcgtttgctgcgcaaaattgcggcgaatgatctggaaaatatgggggatctgtcc
actctagcagacccggatattgtggctgaactgataaagctggtggctcagcagaacggc
tga

DBGET integrated database retrieval system