KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07220Help
Entry
APA42C_07220      CDS       T01818                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00230  Purine metabolism
apw00240  Pyrimidine metabolism
apw01100  Metabolic pathways
apw03030  DNA replication
apw03430  Mismatch repair
apw03440  Homologous recombination
Module
apw_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    APA42C_07220 (holC)
   00240 Pyrimidine metabolism
    APA42C_07220 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    APA42C_07220 (holC)
   03430 Mismatch repair
    APA42C_07220 (holC)
   03440 Homologous recombination
    APA42C_07220 (holC)
Enzymes [BR:apw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     APA42C_07220 (holC)
DNA replication proteins [BR:apw03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     APA42C_07220 (holC)
DNA repair and recombination proteins [BR:apw03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     APA42C_07220 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: BAI17158
Position
complement(745568..746014)
Genome map
AA seq 148 aa AA seqDB search
MTQIGFYHLTRTSVTEALPKLLARTLASGQKAAVWCASKPMLDDLDKALWKVTTPTWLPH
GREGIACPDLQPIWLSMGEDTPNNARFLFLLENRSFPDLAAFERVFDLFDGHDEEAVAAA
RTRWSAAKAAGHELAYWRQEEKGWNRAR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactcagattggtttttaccaccttacgcgcacaagcgtgaccgaggcgctgcccaaa
ctgttggcccgcacactggccagcgggcaaaaagctgctgtgtggtgcgccagcaaaccc
atgttggatgatctggataaagccctgtggaaagtgaccaccccaacatggctgcctcat
gggcgcgaaggcattgcctgtccggatctgcaacccatctggctgagcatgggggaagat
acccctaacaatgcgcgctttctgtttttgctggaaaaccgcagctttcccgatctggca
gcatttgaacgggtgtttgacctgtttgacggccatgatgaggaagccgttgccgccgcc
cgcacccgctggagcgccgccaaagctgctgggcatgaactggcttactggcggcaggaa
gaaaaaggctggaaccgcgcccggtaa

DBGET integrated database retrieval system