KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_09360Help
Entry
APA42C_09360      CDS       T01818                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    APA42C_09360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apw03011]
    APA42C_09360
Ribosome [BR:apw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    APA42C_09360
  Bacteria
    APA42C_09360
  Archaea
    APA42C_09360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Gag_spuma KORA
Motif
Other DBs
NCBI-ProteinID: BAI17373
Position
978989..979399
Genome map
AA seq 136 aa AA seqDB search
MSKPKHPRTLAETEAQAVTRNIRVSPRKLNLVAGLIRNKPASQAVATLTFSKRRIAQEVK
KTLESAIANAENNHQLDVDQLVVKTAEVGKSIVMRRFHARGRGRSARVEKFFSHLKIVVA
ERAAEPEAASSEQKAA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgaagcatccgcgcacactcgcggaaacagaagcgcaggcagttacgcgc
aacatccgggttagcccccgcaagctgaaccttgtggccggcctgatccgcaacaagcct
gcttcccaggccgttgcaacgttgacgttctctaagcgccgtatcgctcaggaagtgaaa
aagacgctggaaagcgcaatcgctaacgctgaaaacaatcaccagttggacgttgaccaa
ctggtggtgaaaacagctgaagttggaaaatccattgtcatgcggcgtttccatgcccgt
ggccgtgggcgttctgctcgcgttgaaaagtttttcagtcacctgaagattgttgtagct
gaacgggctgctgagcctgaagcagcttcttccgaacagaaggcggcctga

DBGET integrated database retrieval system