KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_10710Help
Entry
APA42C_10710      CDS       T01818                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00020  Citrate cycle (TCA cycle)
apw00620  Pyruvate metabolism
apw00650  Butanoate metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Module
apw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA42C_10710
   00620 Pyruvate metabolism
    APA42C_10710
   00650 Butanoate metabolism
    APA42C_10710
Enzymes [BR:apw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     APA42C_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: BAI17508
Position
1124078..1125595
Genome map
AA seq 505 aa AA seqDB search
MTERIRNVALRSKVCPAETASELIKHGDVVGTSGFTGAGYPKEVPKALARRMEAAHDRGE
KYQISLITGASTGPQLDGELAKANGVYFRSPFNTDATMRNRINAGETEYFDNHLGQVAGR
AIQGNYGKFNIALVEATAITEDGGIVPTSSVGNSQTFLNLADKVIIEVNEWQNPALEGIH
DIWDGNVSGAPTRDIVPIVRADQRVGGTVLRVNPDKIAAIVRTNDRDRNAPFAAPDDTAK
AIAGYLLDFFGHEVKQNRLPPSLLPLQSGVGNVANAVLEGLKEGPFENLVGYSEVIQDGM
LAMLDSGRMRIASATSFSLSPEAAEEINNRMDFFRSKIILRQQDVSNSPGIIRRLGCIAM
NGMIEADIYGNVNSTRVMGSKMMNGIGGSGDFARSSYLSIFLSPSTAKDGKISAIVPMAA
HVDHIMQDAQIFVTEQGLADLRGLSPVQRAREIISKCAHPDYRPMLQDYFDRALKNSFGK
HTPHLLTEALSWHQRFIETGSMMPA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgcattcggaacgtcgcgctgcgcagtaaagtatgtccggcagaaaccgca
tccgagttgatcaaacacggtgatgtggtgggcaccagtggttttactggtgcaggctac
cccaaggaagtacccaaggcgctggcccgccggatggaggctgcgcatgatcgaggtgag
aaataccagatcagcctgattacgggtgcttctaccggtccacagctggatggtgagctg
gcaaaggccaacggggtttatttccgttcaccgttcaatacggatgccaccatgcgcaac
cgtatcaatgcgggtgaaacagaatattttgataaccatctggggcaggtggctggccgt
gccattcagggcaattacggcaagttcaacattgctctggtggaagcgacggccattacg
gaagatggcggcattgtgcccacatcttctgttggtaactcccagacattcctcaatctg
gctgacaaagtcattattgaagtgaatgaatggcagaacccggcgctggaaggcattcat
gatatctgggatggcaacgtaagtggtgcgccaacgcgtgatattgtgccgattgtacgg
gcagaccagcgcgtgggcggcacggttttacgtgtaaacccggataaaattgccgccatt
gtgcgcacgaatgatcgggacagaaacgccccgtttgcagcaccggatgatacagccaag
gccattgcgggctatctgcttgatttctttgggcatgaagtcaaacagaaccgtctgcca
ccatcacttctgccgcttcagtctggcgtaggcaacgtggccaacgccgtgctggaaggg
ctgaaggaaggcccgtttgaaaatctggtagggtatagcgaggtcattcaggatggcatg
ttggccatgctggattctggccgtatgcgcattgcctctgccacgtctttctcactcagc
ccggaagccgcggaagaaattaacaaccgtatggatttcttccggagcaagatcattctg
cgtcagcaggatgtcagcaacagtcccggcattatccgccgtttgggctgtattgccatg
aacggcatgattgaggcggatatttacggcaacgtaaactccacccgtgtgatgggctcc
aagatgatgaatggtattgggggttcgggtgacttcgcccgtagctcttatctgtccatc
ttcctgtcgccctccacggccaaagacggcaagatttctgccattgtgcctatggccgcg
catgtggaccacatcatgcaggatgcgcagatttttgtaaccgagcagggtctggcagat
ttgcgtgggctttcacccgtgcagcgtgcgcgtgaaattatttccaaatgcgcacacccg
gattaccggccaatgctgcaggattactttgaccgtgcgctcaagaactcctttggcaag
catacaccccacctgctgacggaagctctttcctggcatcagcggtttattgaaacaggc
tccatgatgcctgcttaa

DBGET integrated database retrieval system