KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_18400Help
Entry
APA42C_18400      CDS       T01818                                 

Gene name
apaG
Definition
(GenBank) unknown function ApaG protein
  KO
K06195  ApaG protein
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Brite
KEGG Orthology (KO) [BR:apw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    APA42C_18400 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: BAI18187
Position
1902872..1903342
Genome map
AA seq 156 aa AA seqDB search
MPDWATSPLLQDPEEAMNELFSSLPVYEAVTENVRVQVQVFWLPDQSEPDEHSYCWAYRI
RIGNDGTEPVQLLERTWHITDTAGHTEYVHGSGVVGELPVIQPGALYEYTSGASLATPGG
FMSGHYLMQDKSSGRRFDASIPAFSLDSPFLLRQIH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactgggccacttctccccttttgcaagatccagaagaagccatgaacgagctc
ttttcctcactgcctgtctatgaggctgttacggagaatgtgcgcgtgcaggtgcaggtg
ttctggctgccagaccaatccgaaccagatgagcattcctattgctgggcctatcgtatc
cgcattggtaacgatggcacagagcctgtgcagcttctggaacgcacatggcacatcacg
gatacggccgggcacacagaatatgtgcacggttctggcgtagtgggagaactgccggtt
attcagcccggtgcgctgtatgaatatacttccggggcatcccttgccacgccgggcggg
tttatgagcgggcattatcttatgcaggacaaaagcagcggcagacggtttgatgccagc
atccctgctttcagtctggacagcccttttctgctccgccagatccactaa

DBGET integrated database retrieval system