KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_06880Help
Entry
APA26_06880       CDS       T01816                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx00230  Purine metabolism
apx01100  Metabolic pathways
Module
apx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    APA26_06880
Enzymes [BR:apx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     APA26_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 RsgA_GTPase AAA_29 AAA_22 ABC_tran AAA_33 AAA_23 MMR_HSR1 APS_kinase Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: BAI11031
Position
708905..709558
Genome map
AA seq 217 aa AA seqDB search
MAHNAQGNHNGAERRRGVCLVISAPSGAGKSTIANALRASEPVLKHSVSVTTRQPRPGEK
EGVHYHFRTMEDFERMAANGELLEWATVFGRGYGTPRAPVEAALAAGHDMVFDIDWQGHQ
QIRRALPDDVVSLFVLPPSLEELERRLRGRASDHPDEIARRMAAARDEISHWREFDHVII
NTDLDRAITEARAVLTAARLQTRRRTGLLDFVASFGA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaacgcacagggtaaccataacggagcagaacggcggcgcggtgtgtgcctg
gttatttctgcgccatccggggcgggtaagtccaccattgccaatgcactgcgtgcttcc
gagcctgtgctcaagcactcggtttccgtgaccacgcgccagccaaggccgggggaaaag
gaaggcgtgcattatcacttccgtaccatggaagattttgagcgcatggccgcaaatggt
gagttgctggaatgggccaccgtgtttgggcgtggttacggcacaccccgcgccccggtg
gaggctgccttggctgccgggcacgatatggtgtttgacatagactggcagggccaccag
caaattcgccgtgcactgcccgatgatgtggtgagcctgtttgtgctgccgccatcattg
gaggaactggaacgccgcctgcgtggccgtgcatcagaccaccccgatgaaattgcccgg
cgcatggccgccgcacgggatgaaatctcgcattggcgggaatttgaccacgtgattatc
aatacggatctggaccgcgccattacggaagcccgcgcggtgctaacggcggcacgcctg
caaacccgtcggcgcacggggctgttggattttgttgccagttttggagcctga

DBGET integrated database retrieval system