KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_07620Help
Entry
APA26_07620       CDS       T01816                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx00860  Porphyrin and chlorophyll metabolism
apx00970  Aminoacyl-tRNA biosynthesis
apx01100  Metabolic pathways
apx01110  Biosynthesis of secondary metabolites
apx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APA26_07620
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APA26_07620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apx01007]
    APA26_07620
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apx03016]
    APA26_07620
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:apx02048]
    APA26_07620
Enzymes [BR:apx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     APA26_07620
Amino acid related enzymes [BR:apx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   APA26_07620
Transfer RNA biogenesis [BR:apx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    APA26_07620
 Prokaryotic type
   Other AARSs
    APA26_07620
Prokaryotic defense system [BR:apx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    APA26_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: BAI11104
Position
complement(789792..791198)
Genome map
AA seq 468 aa AA seqDB search
MTTIRTRFAPSPTGLLHIGNARAALFNFLFARHHGGEFLLRIEDTDRERSTQQAVDVIFD
GLAWMGIEPDEEPVFQSSREDRHREVALELLEKGLAYKCYCTPEELHQMREDAKAKGLPP
RYNGMWRDRDPSEAPAGAPFAVRIKAPREGEATINDLVQGEVRVANAELDDMIILRSDGT
PTYQHAVVVDDHDMAITHVIRGDDHLTNTFRQAMIYRAMGWELPRFGHLPLIHGPDGAKL
SKRHGAQSVVEFREMGYLPEALCNYLLRLGWGHGDAEILSREEQIKLFDIDGVGRSPSRM
DYAKLLHINAVWLRQADDERLTNDVMERFKKMDGVSVDETTRARVAALMPGLKERARTLV
ELAESAAFLGRQVPLTFNDKAQKLLTPEARTMLGELARDLAAVPDFTPEAIDTTLRNFAE
KHELKLGKVAQPVRAAVTGSNTSPGIDATLQALGKDETLARLGAVLHG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccgtacacgcttcgctccgagtcctacaggcctgctgcatattggcaac
gcccgcgcagccctgttcaatttcctctttgcccgtcatcacggcggcgagttcctcctg
cgtattgaggataccgaccgtgagcgttccacccaacaggctgtagacgttatttttgac
ggtctggcctggatggggattgaaccggatgaagaacccgtcttccagtcctcgcgtgag
gatcggcaccgggaagtcgcccttgagctgctggaaaagggcctggcctataaatgctac
tgcacgcctgaagagctgcaccagatgcgtgaggacgccaaggccaagggcctgcccccg
cgctataacggcatgtggcgggaccgggacccctccgaagccccggctggcgcacctttt
gccgtgcgtattaaagccccgcgtgaaggggaagccaccatcaatgacctcgtgcagggt
gaagtgcgcgttgccaatgccgaactggatgacatgatcatcctacggtctgatggcacc
cccacctatcagcacgccgttgtggtggatgaccacgatatggccattacccacgtgatc
cgtggtgatgaccatctgaccaacaccttccgccaagccatgatctaccgcgccatgggg
tgggaacttccgcgctttgggcatctgccgctcattcacgggccggatggcgcaaagctt
tccaaacgccacggcgcgcagtctgtggtggaattccgtgaaatgggctacctgcccgaa
gccctgtgcaactatctgctgcgtctgggctggggccacggggatgcagaaatcctctcg
cgtgaagagcagatcaagctgtttgatattgatggcgttggccgctctccttcccgcatg
gattacgccaagctgctgcacatcaatgctgtatggctgcggcaggcggatgatgaacgc
ctgaccaacgatgtgatggaacgcttcaagaaaatggacggcgtaagtgtggatgaaacc
acccgcgcccgcgtggccgccctgatgccggggctgaaggaacgcgcacgcacgctggtt
gagctggcagaaagtgcggctttccttggccgtcaggtgccgctgacgttcaatgacaaa
gcgcaaaagctgctgacaccagaagcccgcaccatgctgggtgaactggcgcgtgatctg
gccgccgtaccagattttacgccagaagccattgataccaccctgcgcaactttgctgaa
aagcatgagttgaagctgggcaaggtggcccagcctgtgcgcgctgccgtaacaggctcc
aacacctcccccggcattgatgccaccctgcaagcactgggcaaggatgaaaccctcgcc
cgtttgggagccgttctgcatggctag

DBGET integrated database retrieval system