KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_09360Help
Entry
APA26_09360       CDS       T01816                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    APA26_09360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apx03011]
    APA26_09360
Ribosome [BR:apx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    APA26_09360
  Bacteria
    APA26_09360
  Archaea
    APA26_09360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Gag_spuma KORA
Motif
Other DBs
NCBI-ProteinID: BAI11279
Position
978983..979393
Genome map
AA seq 136 aa AA seqDB search
MSKPKHPRTLAETEAQAVTRNIRVSPRKLNLVAGLIRNKPASQAVATLTFSKRRIAQEVK
KTLESAIANAENNHQLDVDQLVVKTAEVGKSIVMRRFHARGRGRSARVEKFFSHLKIVVA
ERAAEPEAASSEQKAA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgaagcatccgcgcacactcgcggaaacagaagcgcaggcagttacgcgc
aacatccgggttagcccccgcaagctgaaccttgtggccggcctgatccgcaacaagcct
gcttcccaggccgttgcaacgttgacgttctctaagcgccgtatcgctcaggaagtgaaa
aagacgctggaaagcgcaatcgctaacgctgaaaacaatcaccagttggacgttgaccaa
ctggtggtgaaaacagctgaagttggaaaatccattgtcatgcggcgtttccatgcccgt
ggccgtgggcgttctgctcgcgttgaaaagtttttcagtcacctgaagattgttgtagct
gaacgggctgctgagcctgaagcagcttcttccgaacagaaggcggcctga

DBGET integrated database retrieval system