KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_15180Help
Entry
APA26_15180       CDS       T01816                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx00562  Inositol phosphate metabolism
apx00564  Glycerophospholipid metabolism
apx01100  Metabolic pathways
apx01110  Biosynthesis of secondary metabolites
apx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:apx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    APA26_15180
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APA26_15180
   00565 Ether lipid metabolism
    APA26_15180
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    APA26_15180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:apx02042]
    APA26_15180
Enzymes [BR:apx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     APA26_15180
Bacterial toxins [BR:apx02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   APA26_15180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 DUF3584
Motif
Other DBs
NCBI-ProteinID: BAI11852
Position
1628610..1631099
Genome map
AA seq 829 aa AA seqDB search
MTTRRNFLKYAFLSGAAGSAGMLPSAISRAFAISPDPGTTYQDAEHIVILMQENRSFDHL
YGTLQGVRGFNDPRAMRQPNGNPVFVQSSTEGQTYVPWRLNIHDTRITWMGSIPHSRESQ
VDAWNNGHHDRWVDVKKSHYKKYEHYPMTMGYYTREDLPFYYALADAFTVCDQNYCGVMT
STCPNRLVFWTGTVRDKQSTDSTVYMRNPEILKSGLTWTTFPERLEQIGVSWKVYQNETD
QVGGLDEKERAWLSNFALNILECFEKYNTSANPRFHEWVDERIKACSKHIEKLQTEERLV
SEKREEQLAEANALLAVLKRRRDAATKTVEQLTPAERSLFERAFVTNKADKNYRTLETLT
FSDGSNTRHMDAPKGDILYQFRKDVKDGQLPTVSWLAAPEHFSDHPASPWYGAWFVSEVM
DILTENPEVWKKTIFIMTYDENDGYFDHCCSFTAPDPKRPETGKSSPSIGPDGLEYTYAK
DEEVMGVPPALARSGPIGLGFRVPMIIASPWSRGGWVNSQLFEHSSTLQFLEKFIEGKFG
KKITETNISPWRRAISGDLTSCFRPYDGSAPQLPFIERDKHLEIIEDARYRPMPSGFKSL
EETEITQIKNNPSQIQQYVKQEPGTRPACALPYELYCNGCLSADGQTISLHLQAGTKVHK
HLSSGAPFNVYTHNMPQEGGMRSSTYAVAAGDNMSVNVDSSLSDNNIYDVSVHAPNGFYR
KFTGRKNGIKLLTECKYMPSGKESVLLCLKNMDHDPLEVHCNVPEHPSLHVLHVPAHGSI
KQEISLAHSSMWYDLTLTTPKEPEFSYVFAGHVDNGHHSITDPAMGLIK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacgtcgtaattttctgaaatatgcgttcctttctggagcggctggttcggcg
ggcatgctgccttccgccattagccgcgcatttgcgatttctcctgatccaggaacgaca
tatcaggatgcagaacatattgttattctgatgcaggaaaaccgttcgttcgatcattta
tacggcacattgcaaggtgttcgtgggtttaacgacccacgggcaatgcggcagccaaac
ggcaacccggtatttgtgcagtccagcacagaagggcagacctatgtgccttggcgcctg
aatatccatgatacacgcattacatggatgggctctatcccccactcgcgcgaaagtcag
gttgatgcctggaacaacggacaccatgatcggtgggtagacgttaaaaagtctcattac
aagaaatacgaacattaccccatgactatgggatattatacacgagaagaccttcctttt
tactacgcattagcagatgcttttactgtttgtgaccaaaattactgtggcgtgatgacc
agcacctgcccgaaccgtctagtgttctggacaggaacggtgcgtgacaaacaaagcact
gattcaaccgtttacatgcgtaacccggaaattcttaaatccggcctgacatggacaacc
tttcctgaaaggttggaacaaattggtgtttcatggaaagtctatcagaatgaaacagat
caggttggcggcctagacgaaaaagaacgcgcttggctttccaactttgcactgaacatt
ctggaatgctttgaaaaatacaatacatcagcaaaccccagatttcatgaatgggtggat
gaacgcataaaggcctgttccaaacatattgaaaaacttcagacagaagaaagacttgtt
tcagaaaaacgagaggaacaattagctgaagccaatgccttgttggctgttctgaaacgc
cgccgcgatgctgctacaaaaacagtggaacaacttactccggcagaacgcagcctgttt
gaacgtgcttttgtaaccaacaaagcagacaaaaattatagaacacttgaaacactgaca
ttttcagatggctccaacacacgccatatggatgcccccaaaggagatatcctttaccaa
ttccgtaaggatgtgaaagacggccagctccccactgtttcgtggttagctgcgccggaa
catttttctgatcacccagcttcaccttggtatggtgcatggtttgtatcagaagttatg
gatattcttactgaaaacccggaagtctggaaaaaaaccattttcattatgacttatgat
gaaaatgatggctattttgaccattgctgctccttcaccgcgccagaccctaaacgccca
gaaactggtaaatcctcccccagcattggacctgacggcctggaatacacttacgccaaa
gatgaagaagttatgggcgtgccgccagcattggcccgtagtggccctattggtctggga
ttccgggttcccatgattattgcatctccatggagccgtggcgggtgggttaattctcaa
ctatttgagcacagctctacccttcagtttcttgaaaagtttattgaaggcaaatttggt
aaaaagattaccgaaacaaatatttctccatggcgccgtgccattagtggagacttaaca
tcctgcttccgcccctatgatggctctgccccacagcttccatttattgaaagagacaag
catctggaaattattgaagatgcacgctaccggcctatgcccagtggctttaaatctctt
gaagaaacagaaattacgcagatcaaaaacaatcctagccagatacagcagtatgtaaaa
caagaaccaggaacacggccggcctgtgccctaccctatgaactatattgtaatggctgc
ttaagcgcagatgggcaaaccatatccttacatctgcaagcgggcaccaaagtgcacaaa
cacctttcatctggcgcaccttttaatgtttacacccacaacatgccacaagaaggcggt
atgcggtccagcacctacgctgtagctgctggagataatatgtctgtaaatgttgatagt
agtttatctgacaataatatttacgatgtatccgtgcatgcgcccaatggtttctaccgc
aaattcaccgggcgtaagaacggcataaagcttttgacagaatgtaaatatatgccatcc
ggcaaggaaagcgttcttctctgcctaaaaaacatggatcacgatccattagaagttcac
tgtaatgtgccggagcatccatctttgcatgttctgcacgttcctgcacacggcagcatc
aagcaggaaatatctcttgcgcactccagcatgtggtatgatttaacgctgacaacacct
aaggaacctgagttttcttatgtttttgctggccatgttgataatgggcaccatagcatt
acagacccagcaatggggcttataaaataa

DBGET integrated database retrieval system