KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_41760Help
Entry
APA26_41760       CDS       T01816                                 

Gene name
recD_traA
Definition
(GenBank) DNA helicase RecD/TraA
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:apx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APA26_41760 (recD_traA)
Enzymes [BR:apx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     APA26_41760 (recD_traA)
DNA repair and recombination proteins [BR:apx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     APA26_41760 (recD_traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 Helicase_RecD HHH_2 AAA_11 PIF1 ArgK T2SSE NTPase_1 RsgA_GTPase AAA_16 AAA_29 ABC_tran AAA_28 IstB_IS21 cobW AAA_24 AAA ATP_bind_1 MMR_HSR1 DEAD NACHT AAA_22 DUF2075 AAA_23 UvrD-helicase ABC_ATPase NB-ARC TsaE MobB TrwB_AAD_bind UvrD_C HHH
Motif
Other DBs
NCBI-ProteinID: BAI13154
Position
pAPA26-013:complement(184391..186610)
Genome map
AA seq 739 aa AA seqDB search
MTSAVVGEQCQTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFV
QMSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAV
FDLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLHSNGVGTSRAVRIFKTYG
QDAVRLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMDEGHC
GLPVGELLTSTAELLEVAAPLIETALALELEAGDVVADSVGETSCIFLAGLYRAEQSIAE
RLRACAVGRPPWPEIDAEKAMTWVEGKTGLAMAPSQQEAVRLALRSKVLVITGGPGVGKT
TLVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPGNGSFKRDDTN
PLTCDLLVVDEASMVDVLLMRSLLRALPDSASLLIVGDVDQLPSVGPGQVLADIIGSDAV
PVVRLTEVFRQAAQSRIITNAHRINEGKMPELSAEEGSDFYFVEAAEPEVGLRKLLAVVK
DRIPARFGLDPVRDVQVLCPMNRGGLGARSLNIELQQALNPAGDVKVERFGWTYGPGDKV
MQIANDYDRDVFNGDLGVIDKIDVEEGELTVLFDGREVVYGFGELDELVLAYATTIHKSQ
GSEYPVVVIPLVTQHYTMLARNLLYTGVTRGRKLVVLVGQKKALAIAVRNQGGRLRWSKL
RDWLVGTSGTGHLSRLKKP
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgccgtggttggagaacaatgccaaacggaagcgctggccggcctcgtggag
cgggtgacgttccacaatgccgagaacggtttctgcgtcctgcgggtgaaggtgcggggg
cagcgcgatctggtcactgtcgtcggccatgccgccatgatctcggcgggtgagttcgtg
cagatgtcggggcgctggttcaacgaccacacccacggcttgcagttcaaggcggagttc
ctcaaggccagtccgccgaccacggtcgaaggcatagagcgctatctcggctcgggcatg
atccggggcattggtcccgtctatgccaaaaaactggtgaaagcgttcggcgaggccgtg
ttcgacctgatcgagcaggaaccgcatcgcctgcgggaagtgacaggcattggtcccaag
cgggccgaacggattgtcggtggctgggcagaccagaaggtgatccgcgagatcatgctg
ttcctgcacagcaacggcgtcggcacgtcgcgggcggtacggatcttcaagacctacggg
caggatgcggtcagactgatcagcgagaacccctatcggttggcgaaggacatccggggc
atcggcttcaaaaccgccgaccagatcgcccggaagatggggatcgcgcctgatgccatg
atccgggtgagggccgggatctcctatgcccttggtgaggcgatggatgaagggcattgc
ggcctcccggtcggtgaactcctgaccagcaccgccgaactgctggaggtcgccgcccct
ctgatcgaaacagccctcgcgctggagctggaagcgggagacgtggtcgctgatagcgtg
ggagagacgagttgcattttcttggctggtctctatcgcgcggagcagagcatcgccgag
cgattgcgcgcctgcgccgtgggtcggccgccctggccggagatcgatgctgaaaaggcc
atgacttgggtggaaggcaagaccggacttgccatggcgcccagccagcaggaagcggtg
cgccttgcactgcgtagcaaggtgctggtgatcacgggtggtcctggcgtgggcaagacc
acgctggtcaacgccattctgaagatcgtgactgccaagggcacagacgtgcaactttgc
gcgccgaccggccgggcggcgaagcgcctgtcggaaagcacggggctggaaggcaagacc
atccatagactgctggagacggatccgggcaatggcagtttcaaacgggacgataccaac
ccgctgacctgcgacctgctggttgtggacgaggccagcatggtcgacgtgctgctgatg
cgctccctgctgcgcgcgttacctgacagcgcgtctctgctgatcgtcggcgacgtggac
cagttgccttctgtcggaccggggcaggtgctggccgatatcattggctccgatgctgtc
cctgtggtgcgcctgaccgaggtgttccgccaggcggcacagagccggatcatcaccaac
gcgcaccggatcaacgaagggaagatgccggagctgagcgcggaagagggatcggatttc
tatttcgtggaggcggctgagcccgaggtcggactgcgcaagttgctggccgtggtgaag
gaccgcatcccggcgcggttcgggctggacccggtccgcgacgtgcaggtgctctgcccg
atgaaccgaggtgggctgggcgcacggtcgctgaatatcgagttgcagcaggcgctgaac
ccggcaggcgacgtgaaggtcgagcggttcggctggacctacggtcccggcgacaaggtg
atgcagatcgccaacgattatgaccgggacgtcttcaacggggatctcggcgttatcgac
aagatcgatgtggaagagggcgaactgacggtcttattcgatggacgggaggtcgtttac
ggcttcggcgagttggacgaactggtgctggcctacgcgacgaccattcacaagagccag
ggctcggaatatccggtagtggtcatcccgctggtgacgcagcattatacgatgctggcg
cggaacctgctttataccggtgttacacgggggcggaagctcgtcgtgctggtcgggcag
aagaaggctctggccatagctgtgcgaaatcagggcggaaggctacgttggtcaaaactg
agagactggctggtgggtacgtcaggtacaggtcatctatcccgcctaaagaaaccttaa

DBGET integrated database retrieval system