KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_04640Help
Entry
APA32_04640       CDS       T01817                                 

Definition
(GenBank) aldehyde/betaine dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00620  Pyruvate metabolism
apz00630  Glyoxylate and dicarboxylate metabolism
apz01100  Metabolic pathways
apz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA32_04640
   00630 Glyoxylate and dicarboxylate metabolism
    APA32_04640
Enzymes [BR:apz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     APA32_04640
    1.2.1.22  lactaldehyde dehydrogenase
     APA32_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAI13857
NITE: APA32_04640
Position
485728..487176
Genome map
AA seq 482 aa AA seqDB search
MADVKQQDLFINNEWVKPTSGNYTPIKSPATGEEVGQAAEGNPQDVDKAVAAAKAAFKGW
SSKPASQRADYLYALKNLVERDKERLATIITSEMGKPIKEARAEVDFAAGLLRFAAENAR
RLQGEIIPGEREGEKILIDRVPHGVVGAIAAWNFPLALCARKIAPALAAGNTIVLKPADG
TPLSGLALAELVQEAGIPAGVVNVVTGSGQGVGVPLVAHKDTPLITMTGSTPAGKKIMAA
AAEHLKEVRLELGGKAPFIVMEDADIPAAVEAAVTARFFNGGQVCTANERTYVHEDVYDR
FTTALKDRIASLKVGDPMDDATDMGPKVNETELEKVDGIVQKAISQGAKLELGGKRLTGG
AFDKGTFYAPTLLTDITPDMDIVQDEVFGPVLSLIKVKDFDEALTRANDSRYGLSAYLFT
NDLSRILRMGRELDFGEIYVNRGSGEEPQGFHHGYRESGLGGEDGQHGLEAYVRTKTIYL
NA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgttaaacagcaggatctgttcatcaataatgaatgggtaaaacccacatct
ggcaattacacacccattaaaagccccgctacgggggaagaagttggccaagccgcagaa
ggcaacccgcaggatgtagataaagccgtggctgccgcaaaagccgcctttaagggctgg
agcagcaaacctgccagccagcgggccgattatctttacgcacttaaaaaccttgttgag
cgggataaggaacgtctggccaccattattacatcggaaatgggcaaacccattaaggaa
gcccgcgccgaggtagattttgccgctggcctactgcgctttgctgcagaaaatgcccgc
aggcttcagggggaaatcattcccggtgagcgtgaaggtgaaaaaatcctgatcgaccgc
gtgccgcacggcgtagtgggggccattgccgcatggaacttcccgctggctctgtgtgcc
cgtaaaattgcaccagcactggctgcgggtaacaccattgtgctcaaacccgctgatggc
acaccactttctggcctggcactggccgaactggtgcaggaagccggtattcccgccggt
gtggtaaatgtggttacgggcagcggccaaggtgtgggcgtgccgctggtggcgcataag
gataccccgcttattaccatgacaggctctacccccgcgggtaagaaaatcatggcagcc
gcagccgaacatcttaaggaagtgcggctggagctaggtggtaaagccccatttattgtc
atggaagatgccgatattcccgcagcggtggaagccgccgttacggcacggttcttcaac
ggcgggcaggtgtgcacagccaacgaacgcacctatgtgcatgaagatgtgtatgaccgc
tttaccacagcgctgaaagatcgcattgccagcctgaaggtgggtgacccgatggatgat
gccacagatatgggccccaaggtaaacgaaaccgagctggaaaaagtagatggcattgtg
caaaaagccatatcacagggtgcaaagctggaactgggtggcaaacgcctaacgggtggc
gcctttgataaaggcaccttctacgcccccacattgctaacagacattaccccggatatg
gacattgtgcaggacgaggtatttggccccgtgctctcccttatcaaggtgaaagacttt
gatgaggccctaacccgcgccaatgatagccgctatgggctttctgcctatctgttcacc
aatgatctctcccgtatcctacgtatgggccgggaactggactttggggaaatttacgtc
aaccgcggatcgggtgaagaaccgcagggcttccaccacgggtatcgtgaaagcggattg
gggggtgaggacggccagcacgggctggaagcctatgtgcgcaccaaaaccatttacctg
aacgcgtaa

DBGET integrated database retrieval system