KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_07980Help
Entry
APA32_07980       CDS       T01817                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00860  Porphyrin and chlorophyll metabolism
apz01100  Metabolic pathways
apz01110  Biosynthesis of secondary metabolites
apz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APA32_07980
Enzymes [BR:apz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APA32_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DRTGG
Motif
Other DBs
NCBI-ProteinID: BAI14188
NITE: APA32_07980
Position
834334..835062
Genome map
AA seq 242 aa AA seqDB search
MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQKLPAAILLTSGQAV
SAAVVAAQQAKALDIPVYAVGDRTAQRARDAGFTHVKSADGDARALVALLQTHQQPECGS
LLLCSGAGQGVELAAWCRQAGFKVVRRVVYAAKPIQHINAQTCTAIQAAKVAVVLFFSAE
SAAGWLAALPEAEQKQLAAQASAVVISGRVAGVLRAAGWQNIRVADHVSAAAVMDALGTY
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcgcggcgtgattgtcacgcgcccggaaccggggctgagtgaaacaatggca
gccgttgcagatacaggctggctgccattggcctcacctgcattggttgtgcagcggcat
acgttgcgcctgccgcaaaaattacccgcagccatattacttaccagtgggcaagctgtt
tctgctgcggttgtagcggcacagcaggccaaagcgctagatataccggtttatgcggta
ggggatcgcacagcccaacgggcgcgagatgccgggtttacgcacgttaaaagtgcggat
ggtgatgcccgtgcgcttgttgcgcttttacaaacccaccaacagccagaatgtggcagc
ctgttgctatgctctggggcagggcaaggcgtagagcttgcggcttggtgcaggcaggcg
gggtttaaggttgtgcgccgggttgtttatgcagccaaaccgatccagcatataaacgct
caaacatgcacagccattcaggctgccaaggtggcggtggttctgtttttttcagcagag
agtgccgctggctggttggccgctttgcctgaggcagaacagaagcagttagctgcgcag
gcaagtgcggtggtgatatctggccgtgtagccggtgtgctgcgtgcggccggttggcag
aacatacgtgttgcagaccatgtatccgccgcagcggttatggatgctttggggacgtat
cccgcataa

DBGET integrated database retrieval system