KEGG   Aquimarina sp. AD1: D1815_13665Help
Entry
D1815_13665       CDS       T05625                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
aqa  Aquimarina sp. AD1
Pathway
aqa00620  Pyruvate metabolism
aqa00630  Glyoxylate and dicarboxylate metabolism
aqa01100  Metabolic pathways
aqa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aqa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D1815_13665
   00630 Glyoxylate and dicarboxylate metabolism
    D1815_13665
Enzymes [BR:aqa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     D1815_13665
    1.2.1.22  lactaldehyde dehydrogenase
     D1815_13665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXT56746
UniProt: A0A3A9YAW7
Position
complement(3129717..3131165)
Genome map
AA seq 482 aa AA seqDB search
MKAKEYQLFINGGWANATSGNTANITSPIDESIVGTVQMGVEEDAKIALEAAEKAQKEWR
KVPPRKRAELMRKFATEIRANKPYLAELLTREQGKIISLAEIEVEVTATFIEYACDWARH
IEGDIMPSDNENEHIYIHKIPRGVVVAITAWNFPLALAGRKIGPALVAGNAIVVKPTQET
PLATLELGFIAEKVGLPKGLLNVVTGSGRVLGNALVENPITKMVTMTGSTPAGQQIFKAA
AQNLTHVQLELGGKAPAIVFADADLDQAAEAAFHSRFDNCGQVCTCNERMYVHEDVYEAF
MEKFMEHLKAYKVGNPLDRSVSMGPKVNASELKNMEHLVEVSVKEGATIASGGKRPEGVE
FEKGHWFEPTVLTDVTQDMTIVHEESFGPILPVIRFSEFDQVIGYANDCEYGLAAMIFTK
DMATILRCNDELEFGEIYVNRGHGEQHQGFHNGYKLSGSGGEDGKYGFEQYLEKKTFYMN
YK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaagaatatcaactttttattaacggaggatgggcgaatgctacatctgga
aatactgctaatattaccagtccaatcgatgaaagcattgtcggtacagtgcaaatgggt
gtggaggaagatgcaaaaattgcactagaagcagctgaaaaagcacaaaaagaatggaga
aaagttcctccaagaaagcgtgcagaactcatgcgaaagtttgctaccgaaataagagct
aataaaccatatctggcggaattactaaccagagaacaaggtaaaattatttctttagca
gaaatagaagtagaagttaccgcaacttttatcgaatatgcttgtgattgggcgagacat
atagaaggcgatattatgccttctgataatgaaaatgaacatatttatatacataaaatt
cctagaggagttgttgtagcaattaccgcttggaactttcctttagcattagcaggtaga
aaaataggtccagctctggtagcaggaaatgcaatcgtagtaaagccaacacaggaaact
cctttagctactttagaattaggttttattgccgaaaaagtaggtttacctaaaggactt
ttaaatgtagtaacaggatcaggaagagtactcggtaacgcattggttgaaaatccaatt
accaaaatggttactatgacaggtagtactccagcgggtcaacaaatttttaaagctgca
gcacagaatcttactcatgttcagttagaacttggaggaaaagcacccgcaatagtattt
gcagatgcggacttagatcaggcagcagaagcagcattccactccagatttgataattgt
ggacaagtatgtacctgtaatgagcgtatgtatgtgcatgaagacgtatatgaagctttt
atggagaaatttatggaacacttgaaagcttacaaagtaggaaatccattagatagaagt
gtatcgatggggccaaaagtaaatgcttcagaattgaaaaacatggagcatttagtagaa
gtgagcgtaaaagaaggagctaccattgcatctggaggaaaaaggcccgaaggagttgaa
tttgaaaaaggacattggttcgaacctacagtacttacagacgtaacccaagatatgact
attgtacacgaagaatcattcggtcctatattacctgtgattaggttttcagagtttgat
caagtgatcggatatgcaaatgattgcgaatatggattagcggctatgatttttaccaag
gatatggcaaccatattgcgatgcaatgatgaattagagtttggtgaaatctatgtaaac
cgaggtcatggagaacaacatcaaggattccataacggatataaactgtcaggaagcgga
ggagaagatggaaagtacggattcgagcagtacctagaaaagaaaaccttttatatgaat
tataaataa

DBGET integrated database retrieval system