KEGG   Aquimarina sp. AD1: D1815_17715Help
Entry
D1815_17715       CDS       T05625                                 

Definition
(GenBank) CoA transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
aqa  Aquimarina sp. AD1
Pathway
aqa00072  Synthesis and degradation of ketone bodies
aqa00280  Valine, leucine and isoleucine degradation
aqa00650  Butanoate metabolism
aqa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D1815_17715
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    D1815_17715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D1815_17715
Enzymes [BR:aqa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     D1815_17715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AXT57493
UniProt: A0A3A9YEV7
Position
4104197..4104895
Genome map
AA seq 232 aa AA seqDB search
MIRKTVAGVVEATEGVKDNMTFMLGGFGLCGIPENSIAELVKKNIKGLTCISNNAGVDDF
GLGLLLQQKQIKKMVSSYVGENEEFERQMLSGELEVELIPQGTLAERCRAAQGGFPAFYT
PAGYGTEVAEGKETREFNGKMYILEKAFEADFAFVKAWKGDEAGNLIFKGTARNFNPCMC
GAAKITVAEVEELVPAGSLDPDQVHIPGIFVQKIFQGDNYEKRIEQRTVRKR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtaaaacagtggctggagttgttgaagctacagaaggagtaaaagataatatg
acctttatgttaggaggttttggtctttgtggaatacctgaaaattctattgcagaattg
gtaaagaaaaatattaaaggattaacctgtatttctaataacgccggtgttgatgatttt
ggtttaggacttttgttacagcaaaaacaaataaaaaaaatggtttcttcttatgttgga
gaaaatgaagaattcgaacgccagatgttaagtggagagttagaagtagaacttattccg
caaggtacattagcagaaagatgtagagctgcgcaaggaggttttcctgcattctataca
cctgctggttatggaacagaagtagcagagggaaaggaaaccagagagtttaatggtaaa
atgtatatacttgaaaaagcttttgaagcagatttcgcttttgtaaaagcttggaaaggc
gatgaagcaggtaatcttatttttaagggaaccgccaggaattttaatccttgtatgtgt
ggtgctgcgaaaattactgttgccgaggtggaggaattggttccggcaggaagtcttgat
cctgatcaggttcatataccaggaatttttgttcaaaaaatattccaaggagataattat
gagaagagaatagaacaacgtacagtgcgtaagagataa

DBGET integrated database retrieval system