KEGG   Aquimarina sp. BL5: D1818_00855Help
Entry
D1818_00855       CDS       T05615                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
aqb  Aquimarina sp. BL5
Pathway
aqb00633  Nitrotoluene degradation
aqb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aqb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    D1818_00855
Enzymes [BR:aqb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     D1818_00855
  1.-  
   1.-.-  
    1.-.-.-  
     D1818_00855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: AXT49436
UniProt: A0A3A9VHR0
Position
complement(171374..171973)
Genome map
AA seq 199 aa AA seqDB search
MSFLESMQNRYTTKKYDPAKKIERSKIQELKEILHLSPSSINSQPWKFTFVSDNDTKQKL
AKVSWLNTNKVLESDTVVVFSRINNIDLFEKQIENELPEGAVNYYKEFIKPQTKEQIKAW
FDKQVYLALGVFLSACPEMGIDATPMEGVEPENYDVILNQTNYSTLMAVAIGYRDDEDFN
QPSKKPKSRRDINKVIETI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttagaatcaatgcaaaaccgttatacaaccaaaaagtatgacccagcaaaa
aaaattgaacgtagtaaaattcaagaattaaaggaaattctgcacttaagcccttcttct
ataaacagtcaaccttggaaattcacttttgtttcggacaacgatacaaaacaaaagcta
gcaaaagtttcttggttaaacaccaataaagttcttgagagtgatacagttgtcgttttt
agtcgaatcaataacatcgacttattcgaaaaacaaattgaaaatgagcttcctgaagga
gcagttaattattacaaagaatttataaaacctcaaacaaaagagcaaataaaagcttgg
tttgataaacaagtatatttagctttaggtgtttttttaagtgcttgtcctgaaatggga
attgatgctacaccgatggaaggagttgaaccagaaaactatgacgtaattctaaatcag
acgaactactctactcttatggcagtagctattggttatagagacgatgaagactttaac
caaccaagtaaaaaaccaaaatctagaagagacataaataaagtaatagaaaccatataa

DBGET integrated database retrieval system