KEGG   Aquimarina sp. BL5: D1818_02860Help
Entry
D1818_02860       CDS       T05615                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
aqb  Aquimarina sp. BL5
Pathway
aqb00473  D-Alanine metabolism
aqb01100  Metabolic pathways
aqb01503  Cationic antimicrobial peptide (CAMP) resistance
aqb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aqb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D1818_02860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D1818_02860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    D1818_02860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:aqb01504]
    D1818_02860
Enzymes [BR:aqb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     D1818_02860
Antimicrobial resistance genes [BR:aqb01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    D1818_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AXT49811
UniProt: A0A3A9W7J3
Position
complement(620174..621670)
Genome map
AA seq 498 aa AA seqDB search
MEFVKKLQESIEKYSDHNVLCINGTFYTYGQFAIEISKIRSAVVNTIEDSEKLIGLVTND
DLQTYASIVALWLEGKAYVPVNPEVPFERNAKVFELTETRYVIDSSESSIYDNHNVIASK
ELTNAEINLVPKEFSGDQLAYILFTSGTTGLPKGVPITFDNIQALVGAIDAEPTFNLEPS
DRCLQMFELTFDFSVVAYLFPLLSGSCMYTIPKGAIKYFYIFKLINEEKLTVLTIVPSII
NYLRPYFSEINAPDVRYCSFGGGALHSEIAKEWSDCLPNCKIFNYYGPTEFTVYSGFYPY
HKETDTKSHNGIIAIGTPQKDTLYLIVNENNEEVGIGETGELCLGGPQITPGYWKNEERN
AQSFFIREENGSPIRYYKTGDLCLKDEEGDFLYVGRADFQVKIRGYRVELAEIEFHAKSR
SDKKVNMVALDITNNLGNAELGLAIESEEFETEYIFDYMKTVMPSYMIPMHVRFIKEFPH
SINGKIDRKELKKHFDIN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgtaaaaaaattacaggaatcaatagaaaaatattcagatcataatgtatta
tgtattaatggaacattttatacttatggacagtttgccatagaaatatccaagattaga
tctgctgtagttaatacgatagaagattcagaaaagctaataggtttagtgaccaatgat
gatcttcagacctatgcgagtattgttgctttatggttagaaggaaaggcatacgttcct
gtaaatccagaagttccattcgaacgaaatgcaaaagtttttgaactaacagaaactagg
tatgtgattgattcttcggaaagttcaatatatgataatcacaatgtaattgcttctaaa
gaattaacaaatgctgagattaatttggttcctaaagaattttcaggagatcaattggct
tatattttgtttacttctggtactactggtttgccaaaaggagtacctatcacatttgat
aatattcaggcgttggtaggagccattgatgcagagccgacatttaatttggaaccatct
gatcgatgtttacaaatgtttgagctaacttttgatttttcagtagttgcttatttgttt
cctttattgtcaggatcttgtatgtatactattccaaaaggagcgattaagtacttttat
atttttaagttgataaatgaagaaaaacttactgtacttactattgtgccgtccattatc
aattatttacgtccttatttttcagaaataaatgcacctgatgtgagatattgtagcttt
ggtggtggtgctcttcatagcgaaatagcaaaggagtggagtgattgtttaccaaattgt
aaaatattcaattattatggccctacagagtttacagtatatagcggtttttatccatat
cataaggaaacagataccaagtcacataacggtatcatagcaattggtactccacaaaaa
gatacgttatatcttatagtaaatgaaaataatgaagaagttggtatcggcgaaacagga
gaattatgtttaggtggaccgcaaataactccagggtattggaaaaatgaagaacgaaat
gctcaaagttttttcataagagaagaaaatggctcacctattaggtactataaaacgggt
gatctttgtttaaaagatgaagaaggagattttttatacgttggtagagcagattttcaa
gtaaaaattagaggctatagagtagaactcgcagaaatagagttccacgcaaaatccaga
tcagacaaaaaagtaaatatggtagctcttgatatcactaataatttaggaaatgcggaa
ttgggattagcaatcgaatccgaggagtttgaaacagaatatatctttgattatatgaag
actgtgatgccaagttatatgatccctatgcatgtgagattcataaaagaatttcctcat
agtatcaatggaaaaattgatagaaaagaattgaaaaaacatttcgacataaactaa

DBGET integrated database retrieval system