KEGG   Aquimarina sp. AD10: D1816_07490Help
Entry
D1816_07490       CDS       T05712                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd00071  Fatty acid degradation
aqd00362  Benzoate degradation
aqd00650  Butanoate metabolism
aqd01100  Metabolic pathways
aqd01120  Microbial metabolism in diverse environments
aqd01200  Carbon metabolism
aqd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D1816_07490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D1816_07490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D1816_07490
Enzymes [BR:aqd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     D1816_07490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 Pyr_redox_2 ApbA NAD_binding_2 UDPG_MGDP_dh_N Pyr_redox NAD_binding_8 NAD_Gly3P_dh_N DAO 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXT60198
UniProt: A0A3A9VQ81
Position
1759253..1761658
Genome map
AA seq 801 aa AA seqDB search
MKRTIKKVAVVGSGIMGSGIACHFANIGVEVLLLDIVPRELNDKEKAKGLTLENKVVRNR
LVNDSLTAALKSKPSPIYHQKFASRITTGNLEDDIAKVADVDWIIEVVVERLDIKKIVFE
NLEKHRTPGTLITSNTSGIPIKFMNEGRSEDFQKHFCGTHFFNPARYLKLFEIIPGPNTS
QEVLDFLNGYGEKFLGKTSVVAKDTPAFIGNRIGIFSIMSLFHMVKEMGLTIEEVDKLSG
PVIGRPKSATFRTVDVVGLDTLVHVANGIAENCTDDERLELFKLPEFINTMMENKWLGSK
TGQGFYKKSVSAEGKKEILSLDLDTLEYRTKKRASFATLEMTKTIDKVVDRFKVLVSGKD
KAGEFYRKTLSALFAYVSNRIPEITDDLYKIDDAMKAGFGWEHGPFQIWDAVGVEKGIEI
MKAEGLEPAAWVNDMIASGSTSFYTVKEGATYFYDIPKKEQTKVPGQDAFIILDNIRKSS
EVFKNSGVVVEDLGDGILNVEFQSKMNTIGGDVLAGLNKAIDIAEKDFQGLVVGNQAANF
SVGANIGMIFMMAVEQEYDELNMAIKYFQDSMMRMRYSSIPTITAPHGMALGGGCEISLH
ADKVVAAAETYMGLVEFGVGVIPGGGGSKEMALRASDLFKKDDVELNILQEHFLTIGMAK
VSTSAYEAFDTNLLQKGKDIVVVNKDRQIATAKAHAKLMAEQGYTQPPRRKDVKVLGKQA
LGMFLVGTDSMEASKYISEHDQKIANKLGFVMAGGDLSEPTLVSEQYLLDLEREAFLSLC
TERKTLERIEHMLKKGKPLRN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaccattaaaaaagttgcagtcgtaggatcaggaataatgggatccggtatt
gcatgtcatttcgctaatattggtgtcgaagtgctattattagatatagttcctagagaa
ctaaacgacaaggaaaaagcaaaaggacttacccttgaaaacaaagtggtacgtaatcga
ttggtaaatgattctcttaccgcagctcttaaatctaaaccttctcctatctatcatcag
aaatttgcaagtagaatcactacaggtaatctggaagatgatattgcaaaagtagcggat
gtagattggattatcgaggttgttgtagaaagacttgatattaaaaaaatagtttttgaa
aacttagagaaacatagaactccagggacattaataacttctaacacctctggtattcct
ataaaattcatgaacgaaggacgcagtgaagattttcaaaaacacttctgcggcacacac
ttcttcaaccctgcacgttatttaaaattgtttgaaatcataccaggacctaatacctct
caagaagtattagatttcctaaatggttatggtgaaaaattcttaggaaagacatctgta
gttgccaaagatactcctgcgtttataggtaacagaataggtatttttagcatcatgagt
ttattccatatggttaaagagatgggattaactattgaagaagtagataaactttctggt
cctgttatcggtcgtccaaaatcagctacttttcgtacagtagatgtagtaggattagat
acattagtacatgttgcaaatggtattgctgagaactgtacagatgatgaacgtcttgag
ttatttaaacttcctgagtttattaacaccatgatggagaataaatggttaggaagtaaa
acgggtcagggattttataaaaaaagtgtttctgctgaaggtaaaaaagaaatcctttct
ctggatctagacacactagaatatagaacaaaaaagagagcttcttttgcaactttagaa
atgactaaaactattgataaagtagtagatcgttttaaagttctagtttcaggaaaagat
aaggctggtgaattttacagaaaaacactatctgctttatttgcatatgtttctaatcgt
atccccgaaatcaccgatgatctatataagattgatgatgcaatgaaagccggatttggt
tgggagcacggaccatttcaaatatgggatgctgttggtgttgaaaaaggaatagaaata
atgaaagcagaaggtttagaacctgcagcttgggtaaatgatatgatcgcttctggtagt
acttcattctatacagtaaaagaaggagctacttatttttatgatatccctaagaaagaa
caaactaaagttcctggacaagatgcctttattattcttgacaatatccgtaaatcatca
gaagtatttaaaaatagtggtgttgttgtagaagaccttggagacggcatcttaaatgtc
gaattccaaagtaaaatgaatactattggtggagatgttttagccggtcttaataaagca
attgatattgctgaaaaagattttcaagggctggttgttggtaatcaggcggcaaatttc
tctgtaggagcaaatattggaatgatatttatgatggcagtagagcaagaatatgatgag
cttaatatggctataaaatatttccaggactctatgatgcgtatgcgatattcttcaatt
ccaacaattacagctcctcatggtatggctcttggtggtggttgtgaaatctcacttcat
gccgataaagttgttgcagctgctgaaacttatatggggttagtagagtttggtgttggt
gtgatccctggtggtggtggatctaaagaaatggcactaagagcttcagatctttttaag
aaagatgatgttgagctaaatatattacaagaacatttcttaactattggtatggctaaa
gtatcaacttctgcctatgaagcattcgacacaaatttacttcaaaaaggaaaagatata
gttgtggttaacaaagatcgccagatcgcaaccgcaaaagctcatgctaagttaatggca
gagcaaggatatacacaacctcctcgtcgtaaagatgttaaagtacttggtaaacaagct
ttaggaatgttcctagtgggtacagattctatggaagctagtaagtacatctctgaacac
gatcaaaaaatagccaataaacttgggtttgtaatggcaggtggagatttatctgaacca
actttagtatcagaacaatatctattagatctagaacgtgaagctttcttgtcattatgt
acagaacgcaagacacttgagcgtatcgagcatatgcttaaaaaaggtaaaccgctaaga
aactag

DBGET integrated database retrieval system