KEGG   Aquimarina sp. AD10: D1816_17545Help
Entry
D1816_17545       CDS       T05712                                 

Definition
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd03060  Protein export
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    D1816_17545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aqd01002]
    D1816_17545
Enzymes [BR:aqd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     D1816_17545
Peptidases [BR:aqd01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   D1816_17545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8 DUF92 SRR1
Motif
Other DBs
NCBI-ProteinID: AXT62085
UniProt: A0A3A9W2I5
Position
complement(4250787..4251401)
Genome map
AA seq 204 aa AA seqDB search
MSLKKSILVIILVLLIDQISKVYIKTHFSLHEEVKVLSWFRIVFVENKGMAWGVELPGSY
GKLILTLFRLVAISGIGYWLYDSIRKNSPKILTFCIALIFAGAFGNIIDSVLYGVLFEES
TRVNIASFLPADGGYETLFYGKVVDMIQFTFYDDILPDWIPFWGGEHFSFFDPVFNIADS
AISVGVFLLIVFYKKAFPKQEEEL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaaagaaatcaatcttagttataatcttagtattgcttattgatcaaattagt
aaagtatatattaagacacattttagtcttcatgaagaagtaaaagtcctaagttggttt
cgaatagtttttgtagaaaataaaggaatggcttggggagtagaacttcctggtagttat
ggaaaacttattcttacattatttagattagtggctatttcaggtattggatactggctt
tatgattctatccgaaaaaacagtccaaagatacttacattttgtattgccctaattttt
gcaggagcttttggaaacataattgattctgttttatacggggttctttttgaagaaagt
actcgagtaaatattgcaagctttttgcctgcagatggtggatatgaaaccttattttat
ggcaaggtggttgacatgattcaatttacattttatgatgatatcctacctgattggata
ccattctggggtggtgaacatttttctttctttgacccagtatttaatattgccgactcg
gctattagtgttggtgtattcttacttatagtattttataaaaaagcatttccaaaacag
gaagaagagttataa

DBGET integrated database retrieval system