KEGG   Aquimarina sp. AD10: D1816_21310Help
Entry
D1816_21310       CDS       T05712                                 

Definition
(GenBank) aromatic amino acid hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd00360  Phenylalanine metabolism
aqd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aqd00790  Folate biosynthesis
aqd01100  Metabolic pathways
aqd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    D1816_21310
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D1816_21310
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D1816_21310
Enzymes [BR:aqd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     D1816_21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H Endotoxin_C2
Motif
Other DBs
NCBI-ProteinID: AXT62773
UniProt: A0A3A9W7V5
Position
complement(5141913..5143673)
Genome map
AA seq 586 aa AA seqDB search
MSQTITSNPLIDRLPAHLKQFIKPQNYEEYTPINQAVWRYVMRKNVTSLSKVAHKSYLKG
LEKTGISVDDIPSMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYNILVIASDIRQLEN
IEYTPAPDIIHEAAGHAPIIANPDYAEYLRRFGKIGCKAISSKKDYEMYEAVRKLSILKE
ASNIDQNDIDNAEKKVEALQNQKSTPSEMALIRNLHWWTVEYGLIGTTEDPKIYGAGLLS
SIGESEWCMTDNVKKISYSPEAAFQDFDITKPQPQLFVTPDFAYLCQVLEEFADTMALRK
GGHRGLAKLIESENLGTIELSTGLQVSGIFNRMIKNEDNEVIYFETKGPTAISFREKELI
GHGVDTHSNGFRSPIGKLKGINLAIENMSPRDLKAYNFYDGEYIEFEFESGITVAGNNIT
GMRNVQGELILIQFSECTIKYKDEFLFKPEWGTFDLAVGKEIVSAFSGPADDNSFDLVTH
VSTTTTVKQEHSSEKNELHELYASVRNIRNGENSKFSLEAIFEIIEKDHQNDWLLSLEIY
ELVHDRDPKFTSQILKYLNELKLKRTEIKHLIDSGLEIIDKDLTIA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaccataacttctaatcctttaattgataggttacctgcacacttgaagcaa
ttcataaagcctcaaaattatgaagagtacaccccaattaatcaagctgtttggagatat
gtaatgcgtaaaaatgttacttctctcagtaaggttgcacataaatcatatttaaaaggt
cttgaaaaaactggaatttcagtagatgatatcccaagtatgtatggcatgaacaggatt
ctaaaagaaattgggtgggctgctgtggctgtagacggttttattcctcctaatgctttt
atggagtttcaggcttataacattctagttattgcatctgatataaggcaattagaaaat
atagaatacactcctgctcctgatatcatacatgaagctgcaggacacgcacctattatt
gcgaatccagattatgctgagtatctaaggcgttttggaaaaattggctgcaaagctatt
tcttctaaaaaagactatgagatgtatgaagcagttcgtaaactttcaattttaaaagaa
gcatcaaatattgatcaaaatgatattgacaatgcagaaaaaaaagtagaagcactgcaa
aatcaaaaatcaacaccttctgaaatggctttaattagaaacctgcattggtggacagtt
gaatacggattgataggtactacagaagatccaaaaatatatggtgctggactcttgtca
tctattggagagagcgagtggtgtatgaccgacaatgtaaaaaaaatatcatactctcca
gaagcggcttttcaggattttgatattacaaaaccccaaccgcaattatttgtgacacct
gattttgcgtatttatgtcaagtcttagaagaatttgcagatactatggccttacggaaa
ggcggacacagaggacttgccaaacttattgaatcagagaatctaggaacaatagaatta
agcacagggttacaagtttcgggaatatttaatcgaatgattaaaaatgaagacaatgaa
gtcatctattttgaaaccaaaggtccaacagcaatatcttttagagaaaaagaacttatt
ggacacggagttgatacgcattctaatggttttagatctcctattggaaaattaaaaggc
attaaccttgctatcgaaaacatgtctcctcgagacctaaaagcatataacttttacgat
ggtgaatatatagaatttgagtttgaaagcggaattactgtagcagggaacaatatcaca
ggaatgagaaacgtacaaggcgaattgattttgattcagtttagtgaatgtaccattaaa
tacaaagacgaatttttatttaaacctgaatggggaacttttgatttagctgttggtaaa
gaaattgtttctgctttctcgggaccagcagatgataattcttttgacttggtaacacat
gtttcaactactacgactgtgaaacaagaacatagctctgagaaaaatgaattgcatgaa
ctctatgcatcggtgcggaacattcgtaatggtgaaaattcaaaattttcgttagaagct
attttcgaaattattgaaaaagatcatcaaaacgactggttactatcgttggaaatctat
gaattggttcatgatagagatccaaaatttacatctcaaattttaaaatatcttaatgaa
ttaaaactcaaaagaactgaaataaaacatctaatcgacagtggtttagaaataattgat
aaagatcttacaattgcctaa

DBGET integrated database retrieval system