KEGG   Aquimarina sp. AD10: D1816_25220Help
Entry
D1816_25220       CDS       T05712                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd00770  Pantothenate and CoA biosynthesis
aqd01100  Metabolic pathways
Module
aqd_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    D1816_25220 (coaBC)
Enzymes [BR:aqd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     D1816_25220 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     D1816_25220 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AXT63502
UniProt: A0A3A9VEN7
Position
6029369..6030577
Genome map
AA seq 402 aa AA seqDB search
MSILSGKKILLGVTAGIAAYKTAALVRLFIKTGAEVKVVMTPAAKDFVTPLTLSTLSKNP
VYSSFYDEDDENAVWNNHVDLGLWADVMIIAPATANTLSKMASGASNNLLLATYLSAKCP
VYFAPAMDLDMYNHPSTHNTFKKLQEFGNIMIPAESGELASGLVGQGRMAEPLNIVDFIE
NDILDKLSLRGQKVLITAGPTYEAIDPVRFIGNHSSGRMGIELAKTAANLGAQVSLILGP
SSLSVNHSLIDVVNVVSAKDMYEAVVSRYHDCDIAIASAAVADYRPKNISDQKIKKADTA
FSIELERTTDILNWMGTEKKDQFLVGFALETENEEDNAKNKLKKKNLNLIVLNSLNDKGA
GFKGQTNKVSLINHKLEIKAFDLKTKSEVAQDIFNEINTLKK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattttaagcggtaaaaagattttattaggtgtcaccgctggtattgctgcatat
aagactgctgctcttgtaagattatttatcaaaacaggagcagaagtaaaagttgttatg
actcccgcagcaaaagattttgttactccacttacactatctacattatcaaagaatcct
gtttattcttcattttatgatgaagatgatgaaaatgcggtttggaataatcatgtggat
cttggtttatgggcagatgtaatgattattgcaccagctacagcaaatacattatcaaaa
atggcttcaggagctagtaataatttattactagctacgtatctatcagcaaaatgccca
gtgtattttgctcctgcaatggatttagatatgtataatcacccttcaacgcataataca
tttaagaaattacaagagtttggtaacataatgattccagcagaatcaggtgaattggca
agcggcttagtggggcaaggaagaatggcagaacctttaaatattgtcgactttatagaa
aacgatattttagataaattgtcacttcgaggtcagaaagtactcattacagctggtcca
acatatgaagcaatagatccggtacgatttataggaaaccattctagtggaagaatgggg
attgaattagctaagactgcagcaaatcttggagcccaagttagcttgatcttaggtccg
tcatcattatccgttaatcatagcttgatagatgttgttaatgttgtaagtgcaaaagat
atgtatgaagcggttgtttctagatatcatgactgtgatatagcaatcgcatctgctgca
gtagcagattatagacctaaaaatatatctgatcaaaaaattaaaaaagcagatacggca
ttttctatcgagttagaaagaaccactgatattttaaactggatgggaaccgaaaagaaa
gatcagtttcttgtgggctttgctttagaaacagaaaatgaagaggacaatgctaaaaat
aaactaaaaaagaaaaacttaaatctaattgttctaaattcacttaacgataaaggagct
ggttttaaagggcaaacgaataaagtgagtttaatcaatcataaattagaaattaaagcg
tttgatttaaaaacaaagtcagaagtcgcacaagatatattcaacgaaattaatacgcta
aaaaaatga

DBGET integrated database retrieval system