KEGG   Aquaspirillum sp. LM1: BXU06_04675Help
Entry
BXU06_04675       CDS       T04696                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00330  Arginine and proline metabolism
aql00360  Phenylalanine metabolism
aql00380  Tryptophan metabolism
aql00627  Aminobenzoate degradation
aql00643  Styrene degradation
aql01100  Metabolic pathways
aql01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aql00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BXU06_04675
   00360 Phenylalanine metabolism
    BXU06_04675
   00380 Tryptophan metabolism
    BXU06_04675
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BXU06_04675
   00643 Styrene degradation
    BXU06_04675
Enzymes [BR:aql01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BXU06_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQR66690
UniProt: A0A1U9JRJ8
Position
complement(1054355..1055821)
Genome map
AA seq 488 aa AA seqDB search
MPPGAAQAAQQLAAGEVRASALLEQCLARIARHNPAINALVTLDEARARRVAAAIDALLV
QGVARFDAQPLLGLPVSIKDAFATQGLRTTSSHAALAHYLPPEDASLVARLKSAGAVVVG
KSNLSELAGDPQCWSPLFGPTRNPWNPTLTPGGSSGGSAAAIAMGFSLLELGSDIGGSIR
IPAAYCGVAGFKASENRLPRSGHIPHLPGAERSVRHLLSFGLLARRVADLQLALPVLVGP
DGQDSETPPLPWRSLPALNRPLRIAWWDDFAGLPLCARTTQALAHTVQRLQAAGHDVQRC
APAGFDWATAWQAFGWLAGSEIGLGLPRWQRWLMAHSAGLLPRDAPLSRAFLHGTRLNLR
QFQWALNRREQLISALDGFLGEWDAWLCPTALTTAYPAFALHPLRPPKPLSVAGQSLPYI
EATLSLTTPFSLTGSPVLSLPAGAVAGVPVGLQLVGRRWQDEALLQVGAQVEAALGPWQA
PPDPDQLR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgggggcggcgcaggcggcgcaacagctggcggcgggtgaagtgcgcgccagc
gcgctgctggaacagtgtctggcgcggattgcccggcataacccggcaatcaacgcgctg
gtgacgctggatgaagccagggcgcggcgggtggcggcggcgatagatgccctgctggtg
cagggcgtggcgcggtttgacgcccagccgctgctggggctgccggtgtcgatcaaggat
gcctttgccactcagggtttgcgcaccaccagcagccatgccgcgctggcccactatctg
ccgcctgaagatgccagcctggtggcccggctcaagtcggctggggcggtggtggtgggc
aagagcaatttgtctgagctggccggcgaccctcagtgctggagcccgctgtttggcccc
actcgcaacccgtggaacccgacgctgacgccagggggcagctcgggcggcagcgcggcg
gccattgccatggggttttctctgctggagctgggcagcgatattggcgggtcgatccgg
attcccgccgcgtattgcggcgtggccgggttcaaggccagcgaaaaccgcctgccgcgc
agcgggcatattccgcatctgcccggcgcagaacgcagcgtgcgccatttgctgtcgttt
ggcctgctggcccggcgcgtggccgacctgcaactggcgctgcccgtgctggtcggcccg
gatggccaggacagcgaaacgccgccgctgccctggcgcagtctgccggcgcttaaccgg
cctctgcgcattgcctggtgggatgactttgccggcctgccactgtgtgcgcgcaccacg
caggcgctggcgcacactgtgcagcgcctgcaagctgctggtcatgatgtgcagcgttgc
gcgcctgccgggtttgactgggccaccgcctggcaggcgtttggctggctggccggcagt
gaaattggcctgggcctgccgcgctggcagcgttggctgatggcgcacagcgccgggctg
ttgccgcgcgatgcgccgctcagccgggcatttttgcacggcacccggctaaacctgcgg
cagtttcaatgggcgctcaaccggcgtgagcagttgatcagcgcgctggacgggtttctg
ggcgaatgggacgcctggctgtgccctaccgcgctgaccacggcctatccggcatttgcc
ctgcatccgctgcgcccgcccaagccattatcggtggccgggcagtcgctgccgtatatt
gaagccaccctgagcctgaccacgccgttttcgctgactggcagcccggtgctcagcctg
ccggcaggcgcggtggcgggggtgccggtggggttgcagctggtgggccgacgctggcag
gacgaggctttgctgcaggtgggggctcaggtggaagcggcgctggggccgtggcaagcg
ccgcccgatccggatcagctgcgctga

DBGET integrated database retrieval system