KEGG   Aquaspirillum sp. LM1: BXU06_09205Help
Entry
BXU06_09205       CDS       T04696                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
aql  Aquaspirillum sp. LM1
Brite
KEGG Orthology (KO) [BR:aql00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BXU06_09205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AQR65214
UniProt: A0A1U9JM93
Position
complement(2128843..2129214)
Genome map
AA seq 123 aa AA seqDB search
MTSPIRVEPQAFYIADQSDPAAHCYVFAYRIQIHNTGEVGAKLLTRHWIITDGGNHVREI
HGDGVVGEQPHLNPGESYEYVSGTVLNTPQGTMRGSFQMSTDDGHTLDAEIPEFLLNSSG
VLH
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccccattcgcgtcgaaccccaggcgttctacattgccgaccaatccgacccg
gctgcgcactgctatgtgtttgcctaccggatccagattcacaataccggtgaagtgggt
gccaagctgctgacccgtcactggatcatcaccgatggcggcaaccatgtgcgggaaatc
cacggtgatggcgtggtgggcgaacagccgcacctgaatcccggtgaaagctacgagtac
gtcagcggcacggtgctgaataccccgcaaggcaccatgcgcggcagttttcagatgagc
accgacgatggtcacaccctggacgcagaaatcccggagtttttgctgaattcttccggc
gtgctgcattga

DBGET integrated database retrieval system