KEGG   Aquaspirillum sp. LM1: BXU06_16275Help
Entry
BXU06_16275       CDS       T04696                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00633  Nitrotoluene degradation
aql01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aql00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BXU06_16275
Enzymes [BR:aql01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BXU06_16275
  1.-  
   1.-.-  
    1.-.-.-  
     BXU06_16275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Cas_Csy1
Motif
Other DBs
NCBI-ProteinID: AQR66429
UniProt: A0A1U9JQS9
Position
3743049..3743702
Genome map
AA seq 217 aa AA seqDB search
MNIAQLATRRYTTKSFDPSRKIPAEQVEQLKTLLRYSPSSTNSQPWHFVLASSDAGKAKV
AEATSGFYVFNAAKVQNASHVVVLCARSEINEAHLARLLAQEDQDGRFATAEAKAGQNNG
RTYFANMHRFDLKDAQHWMEKQVYLALGTLLLGAAALEIDACPIEGFDVKLLNDALDLRA
KGLSAVVVVALGYRAADDFNAALPKSRLPMDEVLSEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcccagcttgccacccgccgctacaccaccaagtcgtttgaccccagccgc
aagattcccgccgagcaggtggagcagctgaaaaccctgctgcgctacagcccgtcgtcg
accaattcgcagccgtggcactttgtgctggccagcagtgacgccggcaaggccaaggtg
gccgaggccaccagcgggttttatgtgttcaacgccgccaaggtgcaaaacgcgtcgcat
gtggtggtgttgtgtgcgcgcagcgaaatcaacgaagcgcatctggcccgcctgctggcg
caggaagatcaggatggccgctttgccacggcggaagccaaggctgggcaaaacaatggc
cgcacttattttgccaatatgcaccgctttgacctgaaagacgcgcagcactggatggaa
aaacaggtgtatctggcgctaggcacactgctgctgggtgccgccgcgctggaaattgac
gcttgcccgattgaaggctttgacgtgaagctgctcaacgatgcgctggatctgcgcgcc
aaggggctttctgccgtggtggtggtggcgctgggctatcgggcggcggatgatttcaat
gcggcgctgccaaaatcgcgtttgccgatggatgaggtgctgagcgagatttaa

DBGET integrated database retrieval system