KEGG   Aquitalea sp. USM4: DKK66_01655Help
Entry
DKK66_01655       CDS       T05865                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs00620  Pyruvate metabolism
aqs00630  Glyoxylate and dicarboxylate metabolism
aqs01100  Metabolic pathways
aqs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DKK66_01655
   00630 Glyoxylate and dicarboxylate metabolism
    DKK66_01655
Enzymes [BR:aqs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     DKK66_01655
    1.2.1.22  lactaldehyde dehydrogenase
     DKK66_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QBJ76954
UniProt: A0A4P6TER1
Position
complement(367835..369268)
Genome map
AA seq 477 aa AA seqDB search
MSEIQQLRHYINGRFIDGADHHVVSNPANGQILAHSPQASTQQVADALSAARAAQRDWAA
RPAIERAAYLRNIAALVRQQVDVLAHTISAEQGKTLALAKVEVGFTADYLDYMAEWARRI
EGEVISSDRAGEQIFLLRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVIKPSEETP
INCHLFSQLVAQSGLPVGVFNVLYGRGATGADMAGSADVDMISFTGSVATGARIAAAAAP
HITKLNLELGGKAPAIVLAGADLDLAARAIHASRIINTGQVCNCAERVYVERKVADAFID
KVASAMAATRYGDPLAVADIDMGPLISRQALERVQAKVAQAVQEGAQLITGGQVADLGSG
FHFQPTVLAGCHGQMEVMRQEIFGPVLPIQVVDSMEEAIALANDSEYGLTSSVYTRDLAK
AMQAMRELDFGETYINRENFEAMQGFHAGVRKSGIGGADGKHGLYEYTHSHVVYLQA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattcagcaattacgtcattacatcaatggccgttttatcgacggggccgat
caccatgtagtgagtaatccggccaatggccagattctggcccattccccgcaagcctcc
acgcagcaggtggctgatgccctgagtgctgcccgtgctgcccagcgagactgggctgcg
cgaccggccatcgagcgtgccgcttatctgcgcaatattgccgcccttgttcgtcagcaa
gtggatgtactggcccataccattagcgcagaacaaggcaaaaccctggcgctggccaag
gttgaagtgggctttacggccgattacctggactacatggccgaatgggcaagacgcatt
gaaggcgaggtcatcagcagcgaccgggccggcgagcagatattcctgctgcgcaagcca
ttgggtgtggtggccggcatcctgccctggaattttcctttctttctgattgcccgcaag
atggcaccggccctgctgaccggcaataccatcgtgatcaagcccagcgaggaaacgccg
atcaactgtcatctgttcagccagttggtggcgcagtcaggcttgccggtcggggtgttc
aatgtgctgtatggtcggggtgcgaccggagctgacatggctggcagcgcggacgtcgac
atgatcagctttaccggcagtgtggcaaccggtgcgcgcattgcggcagcggcagccccg
catatcaccaaactgaatctggagctgggtggcaaggcacctgccatcgtactggctggt
gccgacctcgatctggcggccagggccattcatgcttctcgcatcatcaataccggtcag
gtgtgcaactgtgcagaacgggtgtatgtcgagcgcaaggtggcagatgccttcattgac
aaggtggccagcgcgatggcagcaacccgctatggcgacccgctggcggtggcggatatc
gacatggggccgctgatcagccgtcaggcactggaaagggtgcaggcaaaagtggcgcag
gcggtgcaggagggggcgcagctgattaccggtggccaggtggcggatctggggtctggc
ttccatttccagccaacggtgctggccggctgccacgggcagatggaggtcatgcggcaa
gagatattcggcccggtattgcccatacaggtggtggacagcatggaggaggccattgcc
ctggccaatgattccgagtacggcctgacttcatccgtgtatacccgcgatctggccaag
gcgatgcaggcaatgcgtgaactggactttggcgaaacctatatcaaccgggaaaacttt
gaagcgatgcaagggtttcatgccggagtgcgcaaatccggcatcggtggcgctgatggc
aagcatggtctgtacgagtacacgcatagtcatgtggtgtatttgcaggcttga

DBGET integrated database retrieval system