KEGG   Aquitalea sp. USM4: DKK66_01975Help
Entry
DKK66_01975       CDS       T05865                                 

Definition
(GenBank) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs00010  Glycolysis / Gluconeogenesis
aqs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKK66_01975
Enzymes [BR:aqs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DKK66_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 NIF Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: QBJ77013
UniProt: A0A4P6TJG0
Position
441597..442235
Genome map
AA seq 212 aa AA seqDB search
MKETDMQATRHGKQPVLVFDLGGVLVDWNGIDPLMAVSQGRLEREQARQFWMHTPEVALL
DTGRVTPEEFARLMDERLQLGLGTAAMLQALDDWLQGPYPGVRELLQQLGAHYRLAVLSN
NNALHWGKIERQFDILPLFETCFASHHLGLRKPDLVVYHHVQQALQADAADIIFFDDNIE
CVHSATQAGWQACHTVGFDAVRQAVQAHRLLD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacagacatgcaagcgacacgacacggcaagcagccggtgctggttttcgat
ctgggtggtgtgctggtggactggaacggcatcgaccccctgatggccgtgtcgcaaggg
cgtctggaacgtgaacaggccaggcagttctggatgcatacgccggaggtggcgctgctg
gataccggccgggtgacaccggaggagtttgcccggctgatggatgaacggctgcaattg
ggactgggcactgcggccatgctgcaagcactggacgactggctgcaaggcccctacccc
ggcgtgcgagagctactgcaacaactgggcgcgcactaccggctggccgtgctcagcaat
aacaatgcgctgcactggggcaagatcgagcgccagttcgacatcctgccattgttcgaa
acctgctttgcctcacaccacctgggcttgcgcaagccggatctggttgtttaccaccat
gtgcagcaagcactgcaggcggatgctgccgacatcatcttttttgatgacaacatcgaa
tgcgtgcacagcgccacgcaagcaggctggcaggcctgccacaccgtcggttttgacgcg
gtgcgacaggcggtacaggctcaccgcctgctggactga

DBGET integrated database retrieval system