KEGG   Aquitalea sp. USM4: DKK66_02865Help
Entry
DKK66_02865       CDS       T05865                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs00450  Selenocompound metabolism
aqs00970  Aminoacyl-tRNA biosynthesis
aqs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DKK66_02865
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DKK66_02865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aqs01007]
    DKK66_02865
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aqs03016]
    DKK66_02865
Enzymes [BR:aqs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DKK66_02865
Amino acid related enzymes [BR:aqs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DKK66_02865
Transfer RNA biogenesis [BR:aqs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DKK66_02865
 Prokaryotic type
   Other AARSs
    DKK66_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f DALR_1
Motif
Other DBs
NCBI-ProteinID: QBJ77151
UniProt: A0A4V0ZXW0
Position
complement(629211..631271)
Genome map
AA seq 686 aa AA seqDB search
MSKRKILVTSALPYANAGLHLGHMLEQIQTDVWVRFQKMRGHECYYVCADDTHGAPIMLA
AEKQGITPTQLVDAVRELHLADSQGFLIGHDNYYSTNSPENKAFAEQVYKALRADDKISS
RTIEQLFDPEKQMFLPDRFVKGECPKCAAKDQYGDNCEVCGATYNPTELKNPYSAVSGAK
PVLKTSEHYFFRLGECADFLKGWTSGSSTRADGVSQPHLQPESLNKMNEWIEGGLQDWDI
SRDAPYFGFEIPDAPGKYFYVWLDAPIGYMASFKNLCDSKGIDFDAWFKPDSDAEMYHFI
GKDILYFHALFWPAMLHYSGLRAPTGVFAHGFLTVDGQKMSKSRGTFIQAKSYLDCGLNP
EWMRYYMAAKLNGRIEDIDLNLNDFVARVNSDLVGKYVNIASRSAGFISKRFGGKLADSV
ADTAILHKLQAAAPELAAAFEAREYAKALRDVMALADEVNAYVDANKPWELAKQEGQDAR
LQEVCTVLINAFRLLTIYLKPVLPKLAEGVEAFLGVAPLAWSDADSLLLGNTINTYQHLM
QRIDPALIDKLIEANKQNMQATSNAPAAAAYEPLADTIKIDDFAKVDLRIGKVLACSFVE
GSDKLLQFTVDLGFEQRNIFSGIRSAYQEPEKLVGRNVVVVANLAERKMRFGVSQGMIVC
ASGADDNSGLFLLDVDQGAAPGMRIG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgcaagattctggtaaccagtgcactgccttacgccaacgcggggctgcat
ctgggccacatgctggaacagatccagaccgacgtctgggtgcgtttccagaaaatgcgc
gggcacgaatgctattacgtgtgcgcggacgacacccacggtgcccccatcatgctggcc
gccgaaaagcagggcatcaccccgacccagctggtggatgcagtacgcgagctgcatctg
gctgattcgcagggcttcctgattggccacgacaactactacagcaccaacagtccggaa
aacaaggcattcgccgagcaggtgtacaaggccctgcgtgcggatgacaagatttccagc
cgcaccatcgagcaattgttcgacccggaaaaacagatgttcctgccggaccgcttcgtc
aagggcgaatgccccaagtgtgccgccaaggaccagtacggtgacaactgcgaagtgtgc
ggtgccacttacaacccgaccgagctgaagaacccgtactcggcggtatccggtgccaag
ccagtactgaaaacctccgaacactatttcttccgcctgggcgagtgtgctgacttcctc
aagggctggaccagcggcagcagcacccgtgccgatggcgtgagccagccgcacctgcag
cccgaatcgctcaacaagatgaacgagtggatcgaaggcggcctgcaggactgggacatc
agccgcgatgcaccgtatttcggttttgaaattccggatgcgccgggcaagtacttctat
gtgtggctggatgcgccgattggctacatggccagcttcaagaacctgtgcgacagcaag
ggcatcgattttgacgcctggttcaagccggactcggacgccgagatgtatcacttcatc
ggcaaggacatcctgtacttccacgcgctgttctggccggccatgctgcattactccggc
ttgcgcgcgcccaccggcgtgtttgcccacggcttcctcaccgtggacgggcagaaaatg
tccaagtcgcgcggcaccttcatccaggccaagagctatctggactgcggcctgaacccg
gaatggatgcgctactacatggccgccaaactgaatggccgcatcgaagacatcgacctc
aacctcaatgacttcgtagcccgcgtgaattccgatctggtgggcaagtatgtcaacatc
gccagccgctccgccggtttcatcagcaagcgctttggcggcaagctggcggacagcgtg
gcggataccgccatcctgcacaagctgcaagccgctgcgccggaactggcagccgcgttt
gaagcacgtgagtacgccaaggcactgcgcgacgtgatggcactggccgacgaggtgaat
gcctacgtcgacgccaacaagccgtgggaactggccaagcaggaagggcaggacgcacgc
ctgcaggaagtctgcaccgtgctgatcaacgccttccgcctgctcaccatctacctgaag
ccggtactgcccaagctggccgaaggcgtggaagccttccttggcgtggcaccgctggcc
tggtctgatgccgacagcctgctgttgggcaataccatcaatacttatcagcacctgatg
cagcgcatcgacccggcgctgatcgacaaactgatcgaagcaaacaaacagaatatgcaa
gccaccagcaatgccccggctgccgctgcttacgagccgctggccgataccatcaagatc
gacgactttgccaaggtagacctgcgcatcggtaaagtactggcctgcagctttgttgaa
ggttcggacaagctgctgcagttcactgtggacctgggctttgaacagcgcaatatcttc
tccggcatccgatctgcctatcaggaaccggaaaagctggtgggccgcaatgtggtggtg
gtggccaacctggccgagcgcaagatgcgctttggcgtgtcgcaaggcatgatcgtctgc
gcctccggtgctgacgacaattccggcctgttcctgctggacgtggatcagggcgcggca
ccaggcatgcgtatcggttaa

DBGET integrated database retrieval system