KEGG   Aquitalea sp. USM4: DKK66_06520Help
Entry
DKK66_06520       CDS       T05865                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs00970  Aminoacyl-tRNA biosynthesis
aqs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DKK66_06520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aqs03029]
    DKK66_06520
Enzymes [BR:aqs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DKK66_06520
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DKK66_06520
Mitochondrial biogenesis [BR:aqs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DKK66_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: QBJ77781
Position
complement(1356848..1358299)
Genome map
AA seq 483 aa AA seqDB search
MTNATLKQLSQQLAAGAVSSVELATQYLDRIEALNQQLNAFITVDRARTLADAAAADAAR
AAGNAGLLTGVPMVHKDIFCQQGWKTSCGSRMLDNFISPYSAHVVEQCNAAGLVTLGRAN
MDEFAMGSSNENSYYGAVKNPWDLNAIPGGSSGGSAAAVAARLTPVATATDTGGSIRQPA
SHCGVTGIKPTYGVVSRYGMVAYASSLDQGGPIAQTAEDCALMLNVMAGFDERDSTSLER
AREDYTRDLNQPLAGLRVGLPREYFADGLDGDVAKVIEDAVAELKKQGAQVVDISLPNTE
LSIPAYYVIAPAEASTNLSRYDGVRYGHRAADYKDLVDMYEKTRAEGFGAEVKRRILVGS
YVLSHGYYDAYYLKAQKIRRLIANDFTAAFAQCDVILGPVAPTAAFNIGEKSGDPVQMYL
SDIYTLSVNLAGLPGMSVPAGFDRQGRPVGLQIIGNYFGEAKMLNVAHQFQLATDWHTRA
PAL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgccaccctcaagcaactgtcgcaacaactggcggcgggtgcggtgtcgagc
gtggaattggccacgcaatacctggaccgcatcgaggcgctgaaccagcagctgaacgcc
ttcatcaccgtggaccgcgcccgtaccctggccgatgccgcggcggccgatgctgcccgt
gcggctggcaatgccggcctgctcaccggtgtgcccatggtccacaaggacatcttctgc
cagcagggctggaaaaccagctgtggctccagaatgctggacaacttcatctcgccctat
agcgcgcatgtggtggaacagtgcaatgccgccggcctggtgacgctgggccgcgccaac
atggacgaattcgccatgggctcgtccaatgaaaacagctactacggtgccgtgaaaaac
ccgtgggacctgaacgccattcctggcggctcgtccggtggttccgccgctgctgtcgct
gcgcgcctgacgccggtggccaccgccaccgacaccggtggttccatccgccaaccggcc
agccactgtggcgtcaccggcatcaagcccacttatggtgtggtatcgcgctacggcatg
gtggcttatgcctcctcgctggatcagggcggcccgattgcccagaccgccgaagactgc
gcgctgatgctgaacgtgatggccggtttcgacgagcgtgactccaccagcctggaacgt
gcccgcgaagactacacccgcgacctgaaccagccgctggccggtttgcgcgtgggtctg
ccgcgcgagtactttgccgacggcctggatggcgacgtagccaaggtgattgaagacgcc
gtggccgagctgaaaaagcagggcgcacaggtggtggacatcagcctgcccaatacggag
ctgtccattccggcctactacgtgattgccccggccgaggcctccaccaacctgtcgcgt
tacgatggcgtgcgttacggccaccgtgcggccgattacaaagacctggtggacatgtat
gagaagacccgcgccgaaggctttggcgccgaggtcaagcgccgcattctggtgggcagc
tatgtgctgtcgcacggctattacgatgcttactacctgaaagcgcagaaaatccgccgc
ctgattgccaacgacttcaccgccgcatttgcgcagtgtgacgtgatcctggggccggtg
gcaccgactgctgctttcaatatcggcgagaaatccggcgatccggtacagatgtacctg
tccgacatctacaccctgtcggtcaacctggccggcctgcccggcatgagcgtgccggcc
ggtttcgaccgtcagggccgcccggtgggtttgcagatcatcggcaattattttggcgaa
gcaaaaatgctgaatgtggcgcaccagttccagttggctaccgactggcacacccgcgct
cccgccctgtaa

DBGET integrated database retrieval system