KEGG   Aquitalea sp. USM4: DKK66_11120Help
Entry
DKK66_11120       CDS       T05865                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs00430  Taurine and hypotaurine metabolism
aqs00620  Pyruvate metabolism
aqs00640  Propanoate metabolism
aqs00680  Methane metabolism
aqs01100  Metabolic pathways
aqs01120  Microbial metabolism in diverse environments
aqs01200  Carbon metabolism
Module
aqs_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DKK66_11120
   00640 Propanoate metabolism
    DKK66_11120
  09102 Energy metabolism
   00680 Methane metabolism
    DKK66_11120
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DKK66_11120
Enzymes [BR:aqs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DKK66_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QBJ78575
UniProt: A0A4P6TIU3
Position
complement(2395067..2396227)
Genome map
AA seq 386 aa AA seqDB search
MIKALIAVNAGSSTLKFRAYAMEGGALLMRGLIDHFGQPHTSLSLHDTLHQQLEERELGD
DSREAAVAAMINTLADHGIAVTAVVHRVVHGGSRFHQITRLDESVCQALDDYVPLAPLHQ
PVSLQVIEAFRTVDAGLLQLACFDTAFHASQPEVATRFGIARHWHEEGVRRYGFHGLSYA
SISRRLPELKLAERKVVVCHLGSGSSACAIEHGQSVASSMGFSAVDGLMMGTRPGYLDPE
VVLYWMEHEGMGVREVRRELYKNSGLLGVSGGLSADMRELLASPLPAAREAVELYCYRIV
REIASLAAAMKGLDAIIFTAGIGEHSAEVRGRVLGQLGWLGFAIDHAANLAHARKLTTAD
SQHHAYVLDTDEEGEMARQAFDLLKQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaggccctgattgccgtcaatgccggctcctccacgctcaagttccgcgcctat
gccatggaaggcggtgcgctgctgatgcgcggcctgatcgaccatttcggccagccgcac
accagcctcagcctgcacgacaccctgcatcagcaactggaagagcgcgagctgggtgat
gacagccgcgaagctgccgtggccgccatgatcaacaccctggccgatcacggcattgcc
gtcaccgccgtggtgcaccgcgtggtacacggcggcagtcgcttccatcagatcacccgg
ctggacgagtctgtctgccaggcactggatgactatgtgccgctggccccgctacaccag
ccagtcagcctgcaagtgatcgaagctttccgcaccgtggatgccgggctgctgcaactg
gcctgctttgataccgccttccatgccagccagccggaagtcgccacccgctttggcatt
gcccggcactggcatgaagaaggcgtgcggcgttacggctttcacggtctgtcctatgcc
tccatcagccgtcgcctgccggagctgaagctggccgaacgcaaggtggtggtgtgccat
ctgggcagtggcagcagtgcctgcgccatcgagcatgggcaaagcgtggcatccagcatg
ggcttttctgcggtggacgggctgatgatgggcacacgccccggctatctggacccggaa
gtggtgctgtactggatggaacatgaaggcatgggggtgcgcgaggtacggcgcgagctg
tacaagaactccggcctgctgggcgtctccggcggcctgtcggccgacatgcgcgagctg
ctggcaagccccctgcctgcagcacgtgaagcggtagagctgtactgctaccgcatcgtg
cgggaaattgcctcgctggccgctgccatgaaggggctggatgccatcatctttaccgcg
ggcattggcgaacattcggcagaagtacgtggccgggtgctgggccagctgggctggctg
ggctttgctatcgaccatgcagccaatctggcacatgcccgcaagctgaccactgccgac
agccagcaccatgcttatgtgctggataccgatgaagaaggtgaaatggccagacaggca
tttgacctgctaaagcagtag

DBGET integrated database retrieval system