KEGG   Amphimedon queenslandica (sponge): 100631430Help
Entry
100631430         CDS       T02284                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aqu01002]
    100631430
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aqu03110]
    100631430
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     100631430
Peptidases and inhibitors [BR:aqu01002]
 Serine peptidases
  Family S8: subtilisin family
   100631430
Chaperones and folding catalysts [BR:aqu03110]
 Intramolecular chaperones
  Subtilisin family
   100631430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 100631430
NCBI-ProteinID: XP_019851608
Position
Unknown
AA seq 1235 aa AA seqDB search
MASDETDDLKPFPEHCLIPKKETGAERFLSRFPEHNGKNVVIAILDTGVDPGAPGLSKTP
DGKSKILGLYDSSGSGDVDTSVVRTTTREIGRVIDGLTGRKLKIPNGWTNPSGKWHVGVK
AAFELFPNLLKTRLQKEFVEKEWNPAHLRALAEAERELRDFELHNRIDGNIKNRLKKEDL
QARVDILNSLNSKNNIAGPFYDCIVFNDGSYWKAAIDTTKDGDLRDIPCLCSYKIAQHWV
KFGYNDMFNYSVNVYDNGNLLSIVTTGGSHGTHVASIAAAYFPSSPEKNGVAPGAQIIGI
KVGDTRLSTMETGPSLLRACNILAELHCDLINYSYGEASHWTNKGAVLEEFISLVRKHNV
VFVTSAGNNGPGLSTVGCPGGNTEALIGVGAYVSPDMMEGTYSMLKSKPGIPYTWSSRGP
AADGDLGVSVTAPGGAFTSVPTWTLQCSQMMNGTSMSSPNTCGNIALLLSAIKYRGYDYT
PALIKRVIEKTATPLGSHDPFSIGHGVIQVDKAYDYFREITTLPTTPVDFRVSVSGLQGQ
QSKCRGIYLREPHHFKRSTHHLVTVDPCFPEDTSGWILGPRDKLDFTERITLVPTQPWVH
SSKHIILASSGRQFSVTIDESGLEPGAHYAEVLGYGSREDKGPLFRLPVTVIMPTPLTDK
FTFDCPQLQLSHSTIKRYFFHVPTEATWAELKFTSHNEVTRSKLWVHTIHLLPEKAYREK
ETLDSIILEPEASNTLIVPTVGGHTMELVVTQYWTELHPLTVSFNVSFHSLCPSSNNFIL
HSNTSWTRLDVSCNYRLEELYPEFKLTHHCLARRPTEAVIKPLSNTRQVLIDGKQIYELR
LTYNFYLSKTCEVRPNAHLLSDLLYESPFCGQLWMVYSSNKQLMGSGDAYPKNYSVKLDK
GNYTVILQVRHATRSELESLKDLPITIEIKMPTYILVDISPTRCGQTKWGSTITAKPGST
LPLYVFGPSDDRVSKSAGPNTSPGDFLTGTFTLSKNDLVKKKVVYPVQYILGPKASRGNS
GPPKKKEKDYEGALKEFRLHWMSKGKVSPAELEEEFGDDLEFLMARLTMIEADKKNVWGE
EVATIVSKIQSQINVDEILAQQGTKTDLSQDASERSSTLDKQKATLIETRMLESSLLFRQ
DPVNISHLLVIYTELNKLLDQKDSKLKGFKLKLSESLGFHGLTAKLIEEEMNDKGHNRVF
EEKLVKLYRKLGWEHAAVLTEGWIPRKYSNNYQIF
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgatgagacggacgatctaaaaccttttccagagcactgcctgataccaaag
aaagagactggagctgagaggttcctctctcgtttccctgagcataacgggaagaatgtg
gtcattgctatactggatacgggagtggatcctggcgcccctggactcagtaaaaccccg
gatggtaaatcaaagatactgggactgtatgactcaagtgggagtggtgatgttgatacc
agtgtggtacgcaccaccacaagagagatcggacgcgttattgatggactaactggaagg
aaattaaaaatacctaatggttggactaaccccagtggcaagtggcatgttggggtgaaa
gcagcttttgagctatttcctaatctcctcaagacgagactccagaaagaatttgttgag
aaggaatggaatccagctcatttacgtgctctagctgaggctgagagagaattaagagac
tttgagcttcacaacagaattgatgggaacataaaaaacagattgaagaaagaggatctc
caggctagagttgacatcctaaacagtttaaattcaaagaataacatagcaggacctttc
tatgattgcattgtgtttaatgatggatcctattggaaagctgctattgatacaaccaaa
gatggcgatcttcgtgacattccttgtctttgctcgtacaaaatagcacagcattgggtc
aagtttggatataatgatatgtttaattattcagttaacgtctatgacaatggtaatctt
ctgagcattgttaccactggaggttctcacgggactcacgtggcatcaattgcagctgct
tatttcccatcatctcctgagaagaatggtgtggcccctggggcacagatcattggtatt
aaagttggtgacactagactgagtacaatggagactgggccatctcttcttagagcttgc
aacatattagctgagcttcattgtgatcttatcaattacagttatggcgaggcatctcac
tggaccaataaaggagctgtattagaggaattcatatcactagttaggaagcacaatgtt
gtatttgtaactagtgctggcaacaatggaccaggactgagtactgttgggtgccctggg
ggaaacactgaagcactcattggcgttggtgcttatgtatctccagacatgatggaaggt
acatattccatgctgaaatcaaaaccaggcataccttacacatggagctccagaggacca
gctgctgatggtgatcttggtgtctcagtcactgctcccggcggtgcattcacatcagtg
ccaacgtggacactccagtgcagtcaaatgatgaacggtacctcaatgtcatctcccaat
acttgtggaaacattgctctgctattatcagctattaagtacaggggctatgactatact
ccagctcttataaagagggtcattgaaaagacagcaactcctttaggatctcacgatccc
ttctccattggacatggagttatccaggttgacaaagcttatgattatttcagagagatt
actacactaccaaccaccccagttgattttagggtatctgtcagtggtttacagggacag
cagtcaaagtgtaggggtatctacttgagggagcctcatcatttcaagcgatccactcat
caccttgtcacagttgacccttgcttccctgaggacaccagtggttggattttaggccct
cgtgataaattggactttaccgagaggatcactcttgttcctacgcagccatgggtccac
tcatccaagcacattatactagcatcatcaggaagacagtttagtgtgactattgatgag
tctggtcttgaaccaggagctcattatgctgaagttcttggttatggttccagagaagac
aaaggcccgttgtttagattgccagtgacagttataatgccgacacctttaacagacaag
tttacttttgattgccctcagctccagttatctcattcaactattaagagatatttcttt
catgtaccaactgaagcaacatgggcagaattaaagtttacaagccacaatgaagtgact
cgctctaagctttgggtgcacaccattcaccttttgccagagaaagcttacagagagaaa
gaaaccttagactccatcatactagaaccagaagcaagcaacacgctcatcgtcccaact
gtgggtggacatacaatggagctggttgtgacccagtattggacagagctccatccgctg
actgtgtcttttaatgtttcatttcatagtctgtgtccctcatccaataactttatactg
cattccaacacatcatggacaagacttgatgtgtcctgcaattacagactagaggagctg
tatcctgaattcaaactaactcaccactgcctagcaagacggccaactgaagctgttatc
aagccattgagtaacacaaggcaagttctaatagatggtaaacagatttatgaactaaga
ctcacgtataacttctatttgagtaagacgtgtgaagtgagacccaatgctcatttattg
agtgatttattgtatgagagtcctttctgtggtcagctctggatggtttatagctcaaat
aaacaactgatgggatctggtgatgcataccctaagaattactcagtcaaacttgataaa
gggaactatactgttatactgcaggttcgtcatgctaccagatcagagttggagtcactc
aaggacctgcccatcaccattgagatcaagatgcctacttacatactagtggatattagc
ccaacacgctgcggtcagaccaagtggggatccaccataacagctaagccaggctctact
ctacccctgtatgtatttgggccttcagatgacagagtaagtaagtcagctggtcctaac
accagtcctggtgatttcttgactggaacattcactctatcaaagaatgacttagtcaaa
aagaaagtagtgtatcctgttcagtatattcttggtcctaaagctagcagaggtaactct
ggccctcccaagaagaaggaaaaggattacgagggagctcttaaagaatttagacttcac
tggatgagcaaagggaaagttagtcctgctgagctagaggaagaatttggtgatgattta
gagttcctgatggctagactaacaatgattgaagccgacaaaaaaaatgtatggggtgag
gaagttgctactatagtgagcaagatccaatcacagattaatgtagacgagatattggca
cagcaagggacaaagactgacctatcacaagatgcctcagagagatcaagtactcttgat
aagcagaaggctactcttattgaaacaaggatgcttgagtcttctctgttattcagacag
gatcctgttaatattagtcacttattagttatttatactgaactgaacaagctattggat
cagaaggacagcaagctaaaaggattcaaactgaagctaagtgaatcccttggttttcat
ggactgactgcaaaactcattgaagaggaaatgaatgataaaggacacaacagagtgttt
gaagagaaattagttaaattgtatagaaagttgggctgggagcatgcagctgtgttgaca
gaaggctggataccaagaaaatattcaaataattatcaaatattctga

DBGET integrated database retrieval system