KEGG   Amphimedon queenslandica (sponge): 100631448Help
Entry
100631448         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein LOC100631448
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00970  Aminoacyl-tRNA biosynthesis
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100631448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aqu03029]
    100631448
Enzymes [BR:aqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100631448
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100631448
Mitochondrial biogenesis [BR:aqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100631448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 100631448
NCBI-ProteinID: XP_019854939
UniProt: A0A1X7UE62
Position
Unknown
AA seq 499 aa AA seqDB search
MRVSVFLCKRASLNWPPCVGLEIHAQICSRDKIFSTGPVGSHDPSPNSSLSLFDVAIPGT
MPVINKDCVKAGVLTALALRSRINSRSYFDRKHYFYPDLPGGYQISQNRVPLAVGGYLSV
YNNNNQLINVSIKQVQLEQDSGKIVFGEKTIEGHDTLLDYKRAGVGLMEIVTDPVLIDGS
SAANFIRELRLLLKRIGTCDGNMADGSLRVDANVSVRETGSDGMGTRTEIKNISGIKFLK
KAIDYEIWRHIQVLSKGGVVLPETMRYDERKNVTTPTRGKSSHQDYRFIEEHDLPALLIE
REGLVDECRKILEEIPTDNVVESLSLKYGISLYDAQVLESEDWAIDLFEEVMTQCPQLPV
KLVISWITSELYGLINDRDGMNVCVGNFMSLLILFNQNELTGPQAKKILRLMVKGDSRSP
IDILHDIQTAHYSHTDIVDICETILTEHKEEVSEYISGNDRRRKLLFGFFMGEAMSLTGR
DCDPKEIKGILLELLNNKM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcagtgtctttttatgtaaaagagcctctttgaactggcctccgtgtgtgggc
ctggagatacatgctcagatatgttcaagggacaagatattctcaacggggcctgtggga
tcacatgatccctctccaaactcctccctctcattgtttgacgtggcaatacctgggaca
atgcctgtcattaataaagactgtgtcaaggccggagtgttaactgcattagcgttaaga
tcaagaatcaactctcggtcgtattttgatagaaagcactacttttatcctgatttaccg
ggtgggtaccagattagtcagaatcgtgtaccgttagctgtaggtggatacttatcagtt
tataataacaataatcagttaattaacgtctcaataaaacaagtacaactggaacaagac
agtggtaaaatagtttttggtgaaaagacaattgaaggacacgataccctactggactat
aaaagagctggtgttggactgatggagattgtgactgatcctgttctaattgatggatca
tctgctgctaattttattcgagagctccgcctacttttaaagaggattggaacgtgtgat
ggaaacatggcggatgggtcgttaagagttgatgctaatgtgtcagtgagagagactggt
tctgatggaatgggaacaagaactgaaattaagaatatcagcggaatcaagttccttaag
aaagctattgattacgaaatatggcgacacatacaggtgctaagcaaaggaggcgtggtt
ttacctgagactatgcgctatgacgaaaggaaaaatgtgaccacacccacaagagggaaa
tcctcacatcaggactatagattcattgaggaacacgacctaccagctttattaatagag
agggaggggctggttgatgagtgtaggaagatactggaggagataccaactgataatgta
gtggagtcattatcactgaaatacggaatcagtttgtatgatgcacaagtacttgagagt
gaagattgggctatagacttatttgaagaagtgatgacacagtgtcctcagctaccagtt
aagttagtaatctcttggataacatcagaactgtatggactcattaatgacagagacgga
atgaatgtgtgtgtaggcaacttcatgagtttactgatcctgttcaatcagaatgaactg
actgggccacaggctaaaaaaatattacgattgatggttaaaggtgattcaagatctcct
attgatattcttcatgacattcaaactgcccattactctcacactgatattgttgatatc
tgtgaaacaatattaactgaacataaggaagaagtgagtgagtacatcagtggtaatgat
aggaggaggaagctgctgtttggattcttcatgggagaggctatgtctctcactggtaga
gactgtgatccaaaggaaataaaaggaatattattggaactgttgaacaacaaaatgtaa

DBGET integrated database retrieval system