KEGG   Amphimedon queenslandica (sponge): 100631658Help
Entry
100631658         CDS       T02284                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00071  Fatty acid degradation
aqu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100631658
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100631658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 100631658
NCBI-ProteinID: XP_019851983
Position
Unknown
AA seq 367 aa AA seqDB search
MAFRKVRLLTLSRCCTTPRALSMSSIRQKRKGDDYYIQESKIPTLHFQASLPRLPIPELA
DSCSRYLSAVQPLVSESEFQTTQKLAKDFSKEGSDGSELQKRLMERDKMNKDSSFIADFW
YDMYLKDRRSIVLNHNPFLTFNDDPRNPSQADRAAQIVFAAVRFRNSLSDGVLRPEVFHL
NPEKSDKSWFNLLRFIPQSFSWYGAYMINAFPLDMVQYKKLFGTTRLPYKERDELVTTSD
SRHVIIMRNNHFYEMEVIQSDGSPLLITDIHAQLEAILQDSTPSPSHPLSLLPSLDRTDW
AEARQLLVSDSQNALQLEKINSALFVLSLDDTTPTEPKEAMSVFLHNYGLNRLTALKHIL
QVLNLVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttagaaaggttagactgctcactttatcaagatgctgtactacccccagggcc
ttgagcatgagctctatcagacaaaagaggaaaggagatgactactacattcaagagagc
aagatacctactcttcatttccaggccagtctccccagactccccataccagagttggcc
gatagctgcagtcgctacctctcagctgtacagccactggtcagtgagtcggaatttcag
acgacacaaaaattagcaaaggacttctcaaaggaaggctcagatggatcagaacttcag
aagagattaatggagcgtgacaagatgaataaagacagtagcttcattgcagatttttgg
tatgacatgtatttgaaggatcgtcgctctatagtactcaatcataatccttttttaact
tttaacgatgaccccaggaacccgtcacaggctgatcgtgctgcacagattgtatttgct
gctgttcgttttcgcaattctctttccgatggtgtccttcgtccagaagtgtttcatctt
aatccggagaaaagtgacaaaagctggtttaacctcttaaggtttattccccagtccttc
tcatggtatggcgcttacatgatcaatgctttccccttggacatggtccagtataagaaa
ctctttggtaccactcgattgccctataaggaaagagatgaactggttacaaccagcgat
agtagacatgtcattatcatgaggaataatcatttttatgaaatggaagtgatacaatct
gatggctcccctctactcattactgatatacatgctcaattggaggccattttacaagac
tccacccccagcccctcccaccctctctctctactgccgtcattagatagaaccgattgg
gccgaagccagacaactccttgtatccgactcgcagaatgctcttcaattagagaaaata
aactccgccttatttgtcctttctcttgacgataccacacccaccgagcctaaggaagcc
atgagtgtatttttacataattacggcttgaacaggttaacagcattaaaacatatttta
caagtacttaatcttgtgagttga

DBGET integrated database retrieval system