KEGG   Amphimedon queenslandica (sponge): 100632730Help
Entry
100632730         CDS       T02284                                 

Definition
(RefSeq) dual specificity protein phosphatase 6-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aqu01009]
    100632730
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100632730
    3.1.3.48  protein-tyrosine-phosphatase
     100632730
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    100632730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase CDKN3 Y_phosphatase Init_tRNA_PT Barttin
Motif
Other DBs
NCBI-GeneID: 100632730
NCBI-ProteinID: XP_011410132
UniProt: A0A1X7VVV2
Position
Unknown
AA seq 528 aa AA seqDB search
MMACKDYSNVALIEPHQLARNLHSREDYVLLDCRPVLAYNNCHISGAVNVNFTGLMKKRF
IAGKIGLADLVTTEEGRERFRKSVSSPTVVYDEDTKDVKLLGSSTSISLVLAALTTMGRN
MFVLQGGLNAFGPLHPSLCEMAVPVPHFRNSLPPPPRASTPGMRDQALDWHTAPPVNVLS
FLVLGSEKDARSKLVFDWFNITYVLNVTPTCPNNFEGAGVVYKRIPVSDTGTQKLSNKFT
EAFEYIEEIRKKNGVVLIHCMAGISRSVTLTIAYLMAHFGMSMQDAYQFVKDKRPAISPN
LNFMGQLVEFERELQKNPSPTTLDIKLFGPSEEQRKKSVKLMETIIRTNSFTNLPPPGES
SPRSKEEGGNTENSATTAGPTPSTSQTPFVLKPLSSSKSKRTKKYRESLEVQQEVAESVA
QSSGRSNNNNTVTNSNGDTVTSNSVPAPTSDLSSNISSLHISSNQHSSSHPFPSNKEDTT
SASTGGLPTKGELTVKGEKASLHERSVTPPNRCSPEKMEDKSPSPVVS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatgtaaagactacagtaatgttgcactcatcgagcctcatcagttggctaga
aacttacactcgagggaagattatgtcttattagactgcaggccagtcctggcttataac
aattgtcatattagtggagctgtcaatgttaactttacaggactaatgaagaagagattt
atagctggtaagataggcctggccgatcttgtcacgacagaagagggccgggagaggttt
cgtaaaagcgtttcctctcctactgttgtgtacgacgaagacacaaaagatgtaaagctc
cttgggtcatcgacatcgatctcactagtactagctgcactcaccacaatgggaagaaac
atgtttgtattgcaaggtggtttgaatgcatttggtccattgcaccctagcttatgtgaa
atggctgtccctgtccctcactttcgtaattctctccctcctccaccaagagcatcaaca
ccaggtatgagagatcaagcattggactggcacactgcacctccagtcaatgtcctctct
tttcttgtattggggagtgagaaggatgctagaagcaaactggtatttgattggtttaat
atcacgtacgtccttaacgtcacccctacctgtcccaataattttgaaggagctggcgtg
gtttacaagagaataccagtcagtgacacagggactcagaaactatccaataagtttaca
gaagcatttgaatatattgaggaaatcaggaagaagaatggtgtggtcctcatacattgc
atggcaggtatatcccgctctgtcacactcactatagcttacctaatggcacactttggt
atgtcaatgcaagacgcttatcaattcgtgaaggacaagcgaccagcaatatcaccaaac
ctcaacttcatgggacagcttgttgaatttgagagagaactccaaaagaacccgtcaccc
acgaccctcgacataaagctttttgggccgagcgaagagcagagaaaaaaatcagtgaaa
ctgatggagactattattcgtaccaatagcttcactaacctaccacctcctggtgagtct
tcaccgagatcaaaggaagaaggtgggaatacagagaacagtgcaaccactgctgggcct
acaccatcaaccagtcagactccatttgtacttaaacccctctcttcctcaaagagcaag
aggactaagaagtacagggagagtctggaagtgcagcaagaggttgcagagagtgttgct
caatcgtctggcaggagtaacaataacaatacagttactaatagtaatggcgatactgta
acaagtaatagtgtaccagcccctacctctgatctctcttccaatatctcttctttacac
atttcttcaaaccagcattcatcttcccatccatttccatcaaataaagaagacaccacg
tctgctagcactggagggctgcccactaaaggtgagcttacggttaaaggtgaaaaggct
agtttgcacgaaaggtcagttactccgccaaatcgttgctctccagagaaaatggaggac
aagtcaccgagtccagtagtgtcgtga

DBGET integrated database retrieval system