KEGG   Amphimedon queenslandica (sponge): 100633207Help
Entry
100633207         CDS       T02284                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 1-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100633207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aqu03032]
    100633207
   03036 Chromosome and associated proteins [BR:aqu03036]
    100633207
   03400 DNA repair and recombination proteins [BR:aqu03400]
    100633207
Enzymes [BR:aqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100633207
DNA replication proteins [BR:aqu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100633207
Chromosome and associated proteins [BR:aqu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100633207
DNA repair and recombination proteins [BR:aqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     100633207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR PADR1 zf-PARP BRCT PTCB-BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 100633207
NCBI-ProteinID: XP_003385071
UniProt: A0A1X7VAR1
Position
Unknown
AA seq 883 aa AA seqDB search
MADDDPPYRTEYAKSNRSSCKACRETIAKDSLRMARMVQAPNFDAKIPHWYHFSCFFGPK
MKLVSVSQIGGMGGLRWDDQQKIQAKIDGGGGATAGKKRKKGKSADGEENATKKQKKTES
PEDKALREQNEMIWKIRDKLESHLTKGELKDLLDANGQAIPKGESCILDACADGMVFGSL
GLCEECGGQLRVRTHSYSCAGFISDWTKCTNTTTEAKRRKWVIPKQLKEYDFLKSYKYVP
RTRVFPEAPPTPSPSVGSIASSSSQQPIDPSKPLSGFKIASSGRLSKTKGELKKLIVSLG
GEMSSTVNRNTTLLISNEAEVEENSSTAICAASRYQIPVVDIEYLDDVASGDALGKVKSH
TISSWTASPHLEGSNGREETDSAVFEKVPLTVKMKVKGGGVVDPDSGLDSSHHIYEQSGE
KYTAVLGLVDITKGTNSYYKLQLLESDSGKSYYLFRAWGRVGTTIGGNKLEDFGYDLDDA
LSEFLRLYQEKTGTSWHIRKHARKVPGKFYPIDIDYGEEEGPSLSLSGAGSNSKLAPEIQ
DLIKMIFDIQKMKDAMMEFEIDMKKMPLGKLSKRQILSAYSVLNELQNELTGAKNPSRIL
DGSNRFYTLIPHDFGMAKPPLLETEEMIKSKILMLDNLKEIEIAYSLLKTEGEGSADKDP
LDIHYEKLKTNMSVLDKESEEFKRLVEYVANTHAATHNQYQLEVQEVFNLERHGEKKRYK
PFSKLENRMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCW
TSPQSPVGLMLLCEVALGNMYEREHADYITSLPAGKHSTKGIGRTAPDPTSNYVSESGAI
IPMGKGTTSSSRSTSLLYNEYIVYDVAQINMKYLIKMNFKYRR
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacgacccaccatacaggacagaatatgccaaatccaaccgctcttcttgt
aaagcctgccgtgaaacgattgccaaagactccctgaggatggccaggatggttcaggct
cctaattttgacgctaaaattcctcattggtatcattttagttgtttttttggtcctaaa
atgaagctggtatcagtctcacagattggtgggatgggtgggctcaggtgggacgatcaa
caaaaaattcaagcaaaaattgatggagggggaggagctactgcaggtaagaaacgtaag
aagggtaagtctgcagatggagaagaaaacgccacaaaaaagcagaagaagaccgaaagc
cctgaagacaaagctctgagggaacagaatgaaatgatatggaagattcgtgacaagcta
gagagtcacctaaccaagggagagttaaaggacctactggatgcaaacggacaagctatt
cctaaaggagagagttgtatattagatgcttgtgctgatggtatggtgtttggctcgtta
ggtttatgtgaggagtgtgggggacagctaagggtaaggacccactcgtactcttgtgcc
ggctttatctctgattggaccaaatgcaccaacaccaccacagaggcaaagagaaggaaa
tgggtcataccaaagcagctaaaggaatatgatttcttgaagtcatacaagtatgtccct
aggactcgtgtgtttcctgaggctccgcccacaccctctccaagcgttgggagtatagca
tcgtcaagctcacagcaaccaattgatcccagtaaacctctatcaggttttaaaatagcc
tcctctggtcgtctctctaaaacaaagggtgagctgaagaagctcatagtctcgcttgga
ggagagatgtcatcgacagtcaatcgtaacacgaccctcctcatcagcaatgaagccgaa
gttgaagagaactcctccactgctatatgtgctgcgtcccgttatcagataccagtcgtt
gatattgagtatcttgatgatgtcgctagtggggacgcactgggaaaggtcaagtctcac
actattagttcttggactgcgtctcctcaccttgagggatctaacggaagagaggaaact
gactcggctgtatttgaaaaagttccgctaacagtcaaaatgaaagtgaaaggaggaggt
gttgttgatcccgacagtggtttggacagtagccatcacatctacgagcagtctggtgag
aagtataccgctgttcttggtctcgttgacattaccaaaggaactaattcatattataag
ttgcagctcttggagtcagacagtggaaagagctactatctgttcagagcctgggggcgt
gttggtactaccattggagggaacaaactagaggattttggatatgatttggacgatgct
ttgagcgagttcctccgactctatcaagagaagaccggcaccagctggcacatcaggaag
catgcaaggaaagtccctggaaagttctatcctattgatatcgactatggcgaagaggaa
ggtcccagtttgagcctttcgggagccggcagcaattcaaaactagccccagagatacag
gatttaataaaaatgatatttgacatacagaaaatgaaggatgccatgatggagtttgaa
attgatatgaagaagatgccactcggtaagttatcaaagcgtcagatcctctctgcctac
tccgtcctaaacgagttacaaaatgagctaacgggagccaagaatccttcgagaatactg
gacgggtccaacaggttctacacgctcattcctcatgattttgggatggccaaaccgcca
ctcctggagaccgaagaaatgataaaatcaaagatactgatgctagacaatttgaaagag
attgagattgcttattctttgttgaagacggagggtgaaggctcggccgacaaggatcct
cttgatattcattacgagaaactcaagacgaacatgagcgtcctcgataaagagagcgaa
gagtttaagagactcgtggagtacgtggcaaatacgcatgctgccacgcacaaccagtac
caacttgaagtccaagaggtttttaatctggagcgacacggagagaagaaacgttacaag
ccgttctcaaagcttgagaacaggatgctactgtggcatggatcaagactgaccaatttt
gtgggaatattatcccaaggtttacgtatagctccacccgaggccccagtgacagggtat
atgtttggtaaaggagtgtattttgccgacatggtttcaaagagtgctaattattgctgg
actagtccccagagcccagtgggtctcatgctactctgtgaggtggcactgggtaacatg
tatgagagggaacacgctgattacattactagtctgccagctggtaagcacagcactaaa
ggtattggcaggactgcacctgatcctactagtaattacgtgagtgaatctggagccatt
ataccaatgggtaaaggaacaaccagttcctcaaggagcacatcactcctttataatgag
tacattgtgtacgacgtggctcagattaacatgaagtatctcattaaaatgaactttaag
tatcgtcgctga

DBGET integrated database retrieval system